DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAH and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_003396.1 Gene:YWHAH / 7533 HGNCID:12853 Length:246 Species:Homo sapiens
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:157/249 - (63%)
Similarity:192/249 - (77%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISS 65
            |.:||..:.:|:|||||||||:|..|||.|..::..|:.|:|||||||||||:||||:|||:|:|
  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65

Human    66 IEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDY 130
            ||||....|.|:|||.:|.||.::||||..:|:|:|::|:|.||....  ..||||||.||||||
  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCAT--SGESKVFYYKMKGDY 128

Human   131 YRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACL 195
            :|||||.|:|..:....|.|..|||.|.:|:...:.||||||||||||||||||||.|:|::||.
  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193

Human   196 LAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEE----AGEG 245
            |||.||||||||||||:|:||||||||||||||||||||||.|.||    ||:|
  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAHNP_003396.1 14-3-3_eta 3..241 CDD:206761 151/237 (64%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 147/230 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.