DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAG and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_036611.2 Gene:YWHAG / 7532 HGNCID:12852 Length:247 Species:Homo sapiens
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:249 Identity:158/249 - (63%)
Similarity:194/249 - (77%) Gaps:6/249 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISS 65
            |.:||..|.||:|||||||||:|..|||.|..::..|:.|||||||||||||:||||:|||:|:|
  Fly     1 MTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITS 65

Human    66 IEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDY 130
            ||||....|.|:|:||::.||.::||||..:|.|:|::|:.:||. |: |..||||||.||||||
  Fly    66 IEQKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIP-CA-TSGESKVFYYKMKGDY 128

Human   131 YRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACH 195
            :|||||.|||..|....|:|..||..|.:|:...:.||||||||||||:|||||||.|:|::||.
  Fly   129 HRYLAEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACR 193

Human   196 LAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQ----DDDGGEG 245
            |||.||||||||||||:|:||||||||||||||||||||||.|    |.:.|:|
  Fly   194 LAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAGNP_036611.2 14-3-3_gamma 2..247 CDD:206760 157/248 (63%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 150/230 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.