DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAG and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_036611.2 Gene:YWHAG / 7532 HGNCID:12852 Length:247 Species:Homo sapiens
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:248 Identity:182/248 - (73%)
Similarity:206/248 - (83%) Gaps:9/248 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     2 VDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSI 66
            ||:|:|||||:||||:|||||||.|||:|||....||||||||||||||||||||||||||||||
  Fly     4 VDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSI 68

Human    67 EQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYY 131
            ||||.|  :.:|.::.|.|||::||||..:|.:||.|||.|||...|..  ||||||||||||||
  Fly    69 EQKTEA--SARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNP--ESKVFYLKMKGDYY 129

Human   132 RYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHL 196
            |||||||||:.|.|||:.|:.||.:|.:|||..||||||||||||||:|||||||.|:|::||.|
  Fly   130 RYLAEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQL 194

Human   197 AKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD-----DGGE 244
            ||.|||||||||||||||||||||||||||||||||||||.|.|     :||:
  Fly   195 AKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAGNP_036611.2 14-3-3_gamma 2..247 CDD:206760 182/248 (73%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 175/232 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159675
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18860
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.