DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAE and 14-3-3zeta

DIOPT Version :9

Sequence 1:NP_006752.1 Gene:YWHAE / 7531 HGNCID:12851 Length:255 Species:Homo sapiens
Sequence 2:NP_001014515.1 Gene:14-3-3zeta / 36059 FlyBaseID:FBgn0004907 Length:248 Species:Drosophila melanogaster


Alignment Length:239 Identity:164/239 - (68%)
Similarity:196/239 - (82%) Gaps:2/239 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     3 DREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIE 67
            |:|:||.:||||||:||||:|.::||.|....|||:.|||||||||||||:||||:|||:|||||
  Fly     5 DKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIE 69

Human    68 QKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYL 132
            ||.|  ....|.::.||||:.||.||:.||.::|.:|||:|||.|:..||||||.||||||:|||
  Fly    70 QKTE--ASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYL 132

Human   133 AEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197
            ||.|||:.|....::|..||:.|.||:..::.|||||||||||||||||||||||||:||:|||.
  Fly   133 AEVATGDARNTVVDDSQTAYQDAFDISKGKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQ 197

Human   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEE 241
            ||||||||||||:|:||||||||||||||||||||||.|||..|
  Fly   198 AFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHAENP_006752.1 14-3-3_epsilon 4..233 CDD:206757 156/228 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..255 5/8 (63%)
14-3-3zetaNP_001014515.1 14-3-3 5..234 CDD:413191 158/230 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1059
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.