DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment YWHAB and 14-3-3epsilon

DIOPT Version :9

Sequence 1:NP_003395.1 Gene:YWHAB / 7529 HGNCID:12849 Length:246 Species:Homo sapiens
Sequence 2:NP_732309.1 Gene:14-3-3epsilon / 42186 FlyBaseID:FBgn0020238 Length:262 Species:Drosophila melanogaster


Alignment Length:246 Identity:162/246 - (65%)
Similarity:197/246 - (80%) Gaps:4/246 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     4 DKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIE 68
            ::...|.||||||||||||:|..|||.|.....||:.|||||||||||||:||||:|||:|:|||
  Fly     3 ERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSVAYKNVIGARRASWRIITSIE 67

Human    69 QKTERN--EKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYL 131
            ||.|..  |:|.:|.|.||.::|.||:|||:|:|.:|:|:|||.||..||||||.||||||.|||
  Fly    68 QKEENKGAEEKLEMIKTYRGQVEKELRDICSDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYL 132

Human   132 SEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKT 196
            :|.|:|.:::....||..||:.|.:|:..::.||||||||||||||||||||||||::||.|||.
  Fly   133 AEFATGSDRKDAAENSLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA 197

Human   197 AFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD--AGEGE 245
            |||:||||||||:|||||||||||||||||||||||:.|.:|.|  ||:||
  Fly   198 AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEEVDPNAGDGE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
YWHABNP_003395.1 14-3-3_beta_zeta 4..232 CDD:206758 153/229 (67%)
14-3-3epsilonNP_732309.1 14-3-3_epsilon 4..233 CDD:206757 153/228 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53683
OrthoDB 1 1.010 - - D1176818at2759
OrthoFinder 1 1.000 - - FOG0000128
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100283
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1059
SonicParanoid 1 1.000 - - X206
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.