DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WT1 and CTCF

DIOPT Version :9

Sequence 1:NP_077744.4 Gene:WT1 / 7490 HGNCID:12796 Length:522 Species:Homo sapiens
Sequence 2:NP_648109.1 Gene:CTCF / 38817 FlyBaseID:FBgn0035769 Length:818 Species:Drosophila melanogaster


Alignment Length:430 Identity:99/430 - (23%)
Similarity:150/430 - (34%) Gaps:130/430 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   130 PPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPS--- 191
            |.|....|||.|.: |...|:...|...::..:                        ||||:   
  Fly   141 PKATTSKPPPEPKA-ISVRPARAAAAKAKQSAM------------------------PPPPALVV 180

Human   192 --QASSGQARMFPNAPY-LPSCLE-------SQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPN 246
              .|..|:.|..|..|. .|..||       .:|.|.:.  .|...|.|.......:..|...||
  Fly   181 KVPAPRGRPRKNPVIPKPEPMDLERELEELVDEPDISSM--VTELSDYTVDEAAVEAATATLTPN 243

Human   247 HS--FKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECM 309
            .:  ::.||....:....:::            ..|....::.:.|:|..|       |||    
  Fly   244 EAEVYEFEDNATTEDENADKK------------DVDFVLSNKEVKLKTASS-------TSQ---- 285

Human   310 TWNQMNLGATLKGVAAG---SSSSVKWTEGQ----SNHSTGYESDNHTTPILC--------GAQY 359
                       ...|:|   |.....:|..:    :.||..::.:......:|        |.|.
  Fly   286 -----------NSNASGHKYSCPHCPYTASKKFLITRHSRSHDVEPSFKCSICERSFRSNVGLQN 339

Human   360 RIHTHGVFRGIQDVRRVPGVAP---TLVRSASETS------------EKRPFMCAYPGCNKRYFK 409
            .|:||            .|..|   .|..||..||            :::|..|.  .|.....:
  Fly   340 HINTH------------MGNKPHKCKLCESAFTTSGELVRHTRYKHTKEKPHKCT--ECTYASVE 390

Human   410 LSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTH 474
            |:.|:.|...||||:||||  ..|........:||||...|||.|.:||..|:.:|::|:.||.|
  Fly   391 LTKLRRHMTCHTGERPYQC--PHCTYASQDMFKLKRHMVIHTGEKKYQCDICKSRFTQSNSLKAH 453

Human   475 TRTHTGKTSEKP-FSCRW--PSCQKKFARSDELVRHHNMH 511
            ...|:  ..:|| |.|.:  .:|.:|   :|..|...:||
  Fly   454 KLIHS--VVDKPVFQCNYCPTTCGRK---ADLRVHIKHMH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WT1NP_077744.4 WT1 74..394 CDD:308009 57/308 (19%)
COG5048 386..>514 CDD:227381 46/141 (33%)
C2H2 Zn finger 401..420 CDD:275368 4/18 (22%)
C2H2 Zn finger 428..450 CDD:275368 6/21 (29%)
C2H2 Zn finger 458..478 CDD:275368 7/19 (37%)
C2H2 Zn finger 489..511 CDD:275368 5/23 (22%)
CTCFNP_648109.1 23ISL <116..206 CDD:293226 21/89 (24%)
C2H2 Zn finger 296..316 CDD:275368 3/19 (16%)
COG5048 321..>621 CDD:227381 55/189 (29%)
zf-C2H2 322..344 CDD:278523 4/21 (19%)
C2H2 Zn finger 324..344 CDD:275368 4/19 (21%)
zf-H2C2_2 337..361 CDD:290200 9/35 (26%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
C2H2 Zn finger 381..401 CDD:275368 5/21 (24%)
zf-H2C2_2 394..415 CDD:290200 11/22 (50%)
C2H2 Zn finger 409..429 CDD:275368 6/21 (29%)
zf-H2C2_2 422..446 CDD:290200 12/23 (52%)
C2H2 Zn finger 437..457 CDD:275368 7/19 (37%)
C2H2 Zn finger 467..485 CDD:275368 5/20 (25%)
C2H2 Zn finger 496..516 CDD:275370
C2H2 Zn finger 524..544 CDD:275368
zf-H2C2_2 536..561 CDD:290200
C2H2 Zn finger 552..573 CDD:275368
zf-C2H2 587..609 CDD:278523
C2H2 Zn finger 589..609 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.