DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WT1 and dar1

DIOPT Version :9

Sequence 1:NP_077744.4 Gene:WT1 / 7490 HGNCID:12796 Length:522 Species:Homo sapiens
Sequence 2:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster


Alignment Length:443 Identity:108/443 - (24%)
Similarity:148/443 - (33%) Gaps:158/443 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    50 AAEASAERLQGRRSRGASGSEPQQMGSDVRDLNALL-PAVPSLGGGGGCALPVSGAAQWA----- 108
            :|.|||............|::.||.....:.|..|. ||.||.......::..|.|:..:     
  Fly   454 SAAASATASATATPTAQLGAQQQQQQQQQQQLQQLCPPAAPSTPSTSSSSISSSSASSASRHMFV 518

Human   109 -----PVLDFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVH 168
                 |..|...||:|...:....|......||||                             :
  Fly   519 PPLTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPP-----------------------------Y 554

Human   169 FSGQFTGTAGACRYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSY 233
            ..|...|.        ..|||..|...|.|....|     ||..:        .:|:|       
  Fly   555 QQGHVMGL--------INPPPTLQLLGGAATGSNN-----SCTTT--------LTTLT------- 591

Human   234 GHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDN 298
                       |..:.:.:....||..:.:||   |||                    ||.||  
  Fly   592 -----------PASAIQQQQQQPQQQQVPQQQ---PPP--------------------TPRSS-- 620

Human   299 LYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHT 363
                              |...:|             ..|:|..|..:  |...::.....|.:.
  Fly   621 ------------------GGGRRG-------------RHSHHQPGTAA--HIASLMSVRTVRYNR 652

Human   364 HGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQC 428
                                 |:..|..::|...|.:.||:|.|.|.|||:.|.|.|||||||.|
  Fly   653 ---------------------RNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTC 696

Human   429 DFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGK 481
            .:.:||.||:|||:|.||.|:|||.|||:|..|:|.|:|||||..|.:.|..|
  Fly   697 QWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRHLPK 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WT1NP_077744.4 WT1 74..394 CDD:308009 52/330 (16%)
COG5048 386..>514 CDD:227381 50/96 (52%)
C2H2 Zn finger 401..420 CDD:275368 10/18 (56%)
C2H2 Zn finger 428..450 CDD:275368 12/21 (57%)
C2H2 Zn finger 458..478 CDD:275368 10/19 (53%)
C2H2 Zn finger 489..511 CDD:275368
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 38/103 (37%)
C2H2 Zn finger 671..688 CDD:275368 9/16 (56%)
zf-H2C2_2 680..707 CDD:290200 16/26 (62%)
C2H2 Zn finger 696..718 CDD:275368 12/21 (57%)
zf-H2C2_2 710..735 CDD:290200 14/24 (58%)
C2H2 Zn finger 726..746 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.