DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WT1 and Kah

DIOPT Version :9

Sequence 1:NP_077744.4 Gene:WT1 / 7490 HGNCID:12796 Length:522 Species:Homo sapiens
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:96/240 - (40%) Gaps:69/240 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   279 TDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSN---H 340
            ::||..|.:....:..||::                :||  |:|     .|||....|:..   :
  Fly    69 SNSCASSSSSSTSSRQSSED----------------HLG--LQG-----HSSVHHHHGEQGEILN 110

Human   341 STGYESDNHTTPILCGAQYRI--------HTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFM 397
            ||....|.|..| .||.:|..        .||   |.|.|                    |:...
  Fly   111 STSLLEDEHICP-ECGKKYSTSSNLARHRQTH---RSIMD--------------------KKARH 151

Human   398 CAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQ 462
            |.|  |.|.|..:....||.|.|  .:..:|.|  |.:||||...|:.|.|.|||.|||:|..|:
  Fly   152 CPY--CEKVYVSMPAYSMHVRTH--NQGCECQF--CGKRFSRPWLLQGHIRTHTGEKPFKCGVCE 210

Human   463 RKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRH 507
            :.|:...:|:.|.:||   ::.||.:|  ..|.|.||....|.:|
  Fly   211 KAFADKSNLRAHIQTH---SNTKPHTC--ARCGKAFALKSYLYKH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WT1NP_077744.4 WT1 74..394 CDD:308009 26/125 (21%)
COG5048 386..>514 CDD:227381 42/122 (34%)
C2H2 Zn finger 401..420 CDD:275368 6/18 (33%)
C2H2 Zn finger 428..450 CDD:275368 10/21 (48%)
C2H2 Zn finger 458..478 CDD:275368 5/19 (26%)
C2H2 Zn finger 489..511 CDD:275368 7/19 (37%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 5/22 (23%)
C2H2 Zn finger 121..141 CDD:275368 4/20 (20%)
zf-C2H2 176..198 CDD:278523 10/23 (43%)
C2H2 Zn finger 178..198 CDD:275368 10/21 (48%)
zf-H2C2_2 191..214 CDD:290200 11/22 (50%)
zf-C2H2 204..226 CDD:278523 6/21 (29%)
C2H2 Zn finger 206..226 CDD:275368 5/19 (26%)
zf-H2C2_2 218..242 CDD:290200 9/28 (32%)
C2H2 Zn finger 234..250 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.