DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WT1 and CG12299

DIOPT Version :9

Sequence 1:NP_077744.4 Gene:WT1 / 7490 HGNCID:12796 Length:522 Species:Homo sapiens
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:516 Identity:109/516 - (21%)
Similarity:165/516 - (31%) Gaps:174/516 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   127 PAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPS 191
            |.||...|..|.||..:|             ...|.:.|.||         ....|.......|.
  Fly    31 PNPPQQQPQQPQPPDLTF-------------HCMCCAEFFVH---------PLALYQHMNTLHPH 73

Human   192 QASSGQARMFPNAPYLPSCLESQPAIRNQGYSTV-------------TFDGTPSYG--------- 234
            :..:||..            :..|...::.||.:             :.||:.|.|         
  Fly    74 EPGNGQQE------------QESPGDESEDYSWIFEPVCELAEDGSDSSDGSASSGSDSSSSSDD 126

Human   235 -------HTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPP-------PVYG----------- 274
                   .:.|..::...:.|.....|.....:..:.|.||.|       |.|.           
  Fly   127 DDDDDDDDSSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLHGLVAGPGYNEFQLQMTDPRE 191

Human   275 -----CHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAA-GSSSSVKW 333
                 ...||.|.|..|.||...|..|..|...::.::.....:.|:||.:...|. |:....:.
  Fly   192 STSIFMVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRGRRSNIGAPVMDPALNGNQKCFQC 256

Human   334 TEGQSNHSTGYESDNH------TTPILC-------------GAQYRIH----------------- 362
            |..:::.....:...|      ..|..|             ....|||                 
  Fly   257 THCEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQ 321

Human   363 ---------THGVFRGIQDVRRVPG---VAPTLVRSASETSEKRPFMCAYPGCNKRYFKL----- 410
                     :|.|.:..|.|:...|   .:..|:...:..:....|:|  |.| :|.||.     
  Fly   322 SSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFIC--PEC-EREFKAEALLD 383

Human   411 SHLQMHS------------------------RKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHT 451
            .|::||:                        :.|.||||:.|..  |:|.|::|..|..|.|.||
  Fly   384 EHMRMHTQELVYQCAICREAFRASSELVQHMKNHMGEKPFTCSL--CDRSFTQSGSLNIHMRIHT 446

Human   452 GVKPFQCKTCQRKFSRSDHLKTHTRTHTGKTSEKPFSCRWPSCQKKFARSDELVRHHNMHQ 512
            |.||||||.|.:.|:::..|..|.:.|.|   |||:.|  |.|.|.:::...|.:|...||
  Fly   447 GEKPFQCKLCDKCFTQASSLSVHMKIHAG---EKPYPC--PICGKSYSQQAYLNKHIQAHQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WT1NP_077744.4 WT1 74..394 CDD:308009 60/367 (16%)
COG5048 386..>514 CDD:227381 49/156 (31%)
C2H2 Zn finger 401..420 CDD:275368 8/47 (17%)
C2H2 Zn finger 428..450 CDD:275368 8/21 (38%)
C2H2 Zn finger 458..478 CDD:275368 6/19 (32%)
C2H2 Zn finger 489..511 CDD:275368 6/21 (29%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 23/161 (14%)
C2H2 Zn finger 256..276 CDD:275368 2/19 (11%)
zf-H2C2_2 268..293 CDD:290200 3/24 (13%)
C2H2 Zn finger 284..304 CDD:275368 2/19 (11%)
zf-H2C2_2 296..321 CDD:290200 3/24 (13%)
zf-C2H2_2 312..>387 CDD:289522 14/77 (18%)
C2H2 Zn finger 312..332 CDD:275368 0/19 (0%)
C2H2 Zn finger 340..360 CDD:275368 3/19 (16%)
C2H2 Zn finger 369..389 CDD:275368 7/22 (32%)
C2H2 Zn finger 397..417 CDD:275368 0/19 (0%)
zf-H2C2_2 409..434 CDD:290200 9/26 (35%)
C2H2 Zn finger 425..445 CDD:275368 8/21 (38%)
zf-H2C2_2 437..462 CDD:290200 14/24 (58%)
C2H2 Zn finger 453..473 CDD:275368 6/19 (32%)
zf-H2C2_2 465..490 CDD:290200 11/29 (38%)
C2H2 Zn finger 481..501 CDD:275368 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.