DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WT1 and luna

DIOPT Version :9

Sequence 1:NP_077744.4 Gene:WT1 / 7490 HGNCID:12796 Length:522 Species:Homo sapiens
Sequence 2:NP_001260879.1 Gene:luna / 2768719 FlyBaseID:FBgn0040765 Length:570 Species:Drosophila melanogaster


Alignment Length:511 Identity:126/511 - (24%)
Similarity:190/511 - (37%) Gaps:110/511 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     4 LLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAA-EASAERLQGRRSRGAS 67
            :||..|.|...|.|:                             :|:| ..:...:....|..:|
  Fly   133 VLLAAPPSAISPNPS-----------------------------IGSAGNMTPTSISNSSSISSS 168

Human    68 GSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFA------PPGASAYGSLGG 126
            .|.....|:.....|.:...:.|||.|.  .:.||.....||.:...      .||::|...||.
  Fly   169 NSHSNSNGNTTGSSNIIASPLSSLGSGS--TITVSSRNSSAPGIKVRVVQAKNHPGSNARMHLGH 231

Human   127 PAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGACRYGPFGPPPPS 191
            ......|...||..|.|.::   |...|:..|...|:|.......|........:.....|.|.:
  Fly   232 VQDFVLPTLTPPSSPESNLR---SHNYAQQLEANDLAALIQQQQQQQQQQQQQQQQQQLNPQPGN 293

Human   192 QASSGQARMFPNA--PYLPSCLESQPAIRNQ---------GYSTVTFDGTPSYGHTPSHHAAQFP 245
            ...:.....|.:.  |.:....:.|..:..|         |:|.:   |:.|...:.|..:....
  Fly   294 STPATAILRFTSQSNPTMTQLQQQQQQLAVQHLSISPQALGHSNI---GSNSPKSSSSSSSNSSN 355

Human   246 NHSFKHEDPMGQQGSLGEQQYS-VPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECM 309
            :.|..|.......||..:..:| :|.......|..:...|:..:.|.      .:.||.:.    
  Fly   356 SSSSSHSSSSSISGSSDQPTHSNIPRSTIVRLTTANGKPGAAGISLA------RVIQMQNN---- 410

Human   310 TWNQMNLGATLKGVA-AGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDV 373
              ...|:.|.|...| :|||:|   ....|:.:|...|.|..||     |.::            
  Fly   411 --GNANVAAVLSAAANSGSSNS---NSNSSSSNTSSNSINTATP-----QQQV------------ 453

Human   374 RRVPGVAPTLVRSASETS----------------EKRPFMCAYPGCNKRYFKLSHLQMHSRKHTG 422
                 ::....:||:.:|                ::|...|.:.||.|.|.|.|||:.|.|.|||
  Fly   454 -----LSQRSEKSANGSSKPHHPRQHHSDHSPDAKRRIHKCQFLGCKKVYTKSSHLKAHQRTHTG 513

Human   423 EKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTH 478
            ||||:|.::.||.||:|||:|.||.|:|||.|||:|:.|.|.|||||||..|.:.|
  Fly   514 EKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCRNCDRCFSRSDHLALHMKRH 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WT1NP_077744.4 WT1 74..394 CDD:308009 66/354 (19%)
COG5048 386..>514 CDD:227381 52/109 (48%)
C2H2 Zn finger 401..420 CDD:275368 10/18 (56%)
C2H2 Zn finger 428..450 CDD:275368 12/21 (57%)
C2H2 Zn finger 458..478 CDD:275368 11/19 (58%)
C2H2 Zn finger 489..511 CDD:275368
lunaNP_001260879.1 COG5048 <455..>559 CDD:227381 45/103 (44%)
C2H2 Zn finger 489..511 CDD:275368 11/21 (52%)
zf-H2C2_2 503..>519 CDD:290200 11/15 (73%)
C2H2 Zn finger 519..541 CDD:275368 12/21 (57%)
zf-H2C2_2 533..558 CDD:290200 14/24 (58%)
C2H2 Zn finger 549..569 CDD:275368 11/19 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.