DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9B and wntD

DIOPT Version :9

Sequence 1:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:122/298 - (40%) Gaps:71/298 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    95 CQFQFRHERWNCSLEGRMGLLKRGFK--------ETAFLYAVSSAALTHTLARACSAGRMERCTC 151
            ||..|:.:||||..:   ..:::..|        |..::.|:|.||:.|||.:.|:.|.:..|.|
  Fly    51 CQQSFQWQRWNCPSQ---DFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANGVIAGCGC 112

Human   152 DDS----PGLESRQAWQWGVCGDNLKYSTKFLSNF---LGSKRGNKDLRARADAHNTHVGIKAVK 209
            .::    |            |...   .||.|..:   .||..|       |..||..|....::
  Fly   113 TENALNVP------------CAHE---PTKALEQYEKHFGSGSG-------AIGHNRRVVGALLQ 155

Human   210 SGLRTTCKCH---GVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLE-LWAP 270
            ..|...|:|.   .|.|.|....|...|.||....|.|...||.|:::..|::    .|: :|..
  Fly   156 RSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASS----NLKIMWQN 216

Human   271 ARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYS--PGTAGRVCSREA--------SCSSLCCGRG 325
            ....|           ||:|:|||::|......  .||.||.||::.        ||..||...|
  Fly   217 IPLDS-----------LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270

Human   326 YDTQSRLVAFS--CHCQVQWCCYVECQQCVQEELVYTC 361
            |..:|:.|...  |:|::.|...::|..|||.|..|:|
  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 82/298 (28%)
wntDNP_650272.1 wnt 41..308 CDD:302926 81/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.