DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9B and Wnt10

DIOPT Version :9

Sequence 1:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:401 Identity:116/401 - (28%)
Similarity:176/401 - (43%) Gaps:105/401 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    66 LSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNC---SLEGR----MGLLKRGFKETA 123
            |::.|.:||.:...:.....:...:.:.|||.||:..||||   |.:.|    ..|||:|::|:|
  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146

Human   124 FLYAVSSAALTHTLARACSAGRMERCTCDDSPG----------------------LESRQ----- 161
            |.:|:|:|.:.|::|||||.||:..|.||.:..                      ||:.|     
  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211

Human   162 ------------AWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRT 214
                        .|:||.|..|:.:..::...||..:....|::::.:.||.|.|..||.:.:..
  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276

Human   215 TCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSA---------------------- 257
            .|||||:||||.::||||....|...|:|||.::..|:.|..:                      
  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341

Human   258 -----------TNEALG----------------RLELWAPARQGSLTKGLAPRS----GDLVYME 291
                       :.:|.|                .|.:....||.|..|..|..:    ..|.|.:
  Fly   342 SGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQ 406

Human   292 DSPSFCRPSKYS--PGTAGRVCSREAS----CSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQ 350
            .||:||.....:  .||.||.|:|..:    |:|||||||:....:..|..|||:.||||.|||:
  Fly   407 RSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECE 471

Human   351 QCVQEELVYTC 361
            :|..||.:..|
  Fly   472 ECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 116/401 (29%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 107/383 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.