DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9B and Wnt5

DIOPT Version :9

Sequence 1:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:469 Identity:131/469 - (27%)
Similarity:189/469 - (40%) Gaps:190/469 - (40%)


- Green bases have known domain annotations that are detailed below.


Human    66 LSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCS------LEGRMGLLKRGFKETAF 124
            ||..||:.|.:...:...:...|...:.||||||::.|||||      :.|.|..|  ...|.||
  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSL--AAPEMAF 616

Human   125 LYAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQA---WQWGVCGDNLKYSTKFLSNFLGS- 185
            ::|:::|.:|..:||||..|::..|:|  |.|...:|.   |:||.|||||:::.||.::|:.| 
  Fly   617 IHALAAATVTSFIARACRDGQLASCSC--SRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSR 679

Human   186 ----------------------------------------------------------------- 185
                                                                             
  Fly   680 EKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHI 744

Human   186 ------------------------------------------------------KRGNKDLRARA 196
                                                                  |:..|:.||.|
  Fly   745 LNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAA 809

Human   197 DA---------------------------------HNTHVGIKAVKSGLRTTCKCHGVSGSCAVR 228
            ||                                 ||...|.:||....|.|||||||||||::.
  Fly   810 DAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLI 874

Human   229 TCWKQLSPFRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGL---APRSGDLVYM 290
            |||:|||..||.|..|:.:|:.|.||.  .|:. |||::          |.|   .|.:.||:|:
  Fly   875 TCWQQLSSIREIGDYLREKYEGATKVK--INKR-GRLQI----------KDLQFKVPTAHDLIYL 926

Human   291 EDSPSFCRPSKYS---PGTAGRVCSREA----SCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVE 348
            ::||.:||.| |:   |||.||||.:.:    ||:.|||||||:|::.:|...|:|:..|||.|:
  Fly   927 DESPDWCRNS-YALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVK 990

Human   349 CQQCVQEELVYTCK 362
            |:.|.:....:|||
  Fly   991 CEVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 129/467 (28%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 129/467 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152255
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.