DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9A and wntD

DIOPT Version :9

Sequence 1:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:384 Identity:86/384 - (22%)
Similarity:139/384 - (36%) Gaps:121/384 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    16 GLTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAE 80
            |:|..|||:....:|:..|..:    .||:.| :...:...:|.|                    
  Fly    10 GITSTLAAVLEPMSYYQYTQFQ----APLSWE-DITGKGLKQALD-------------------- 49

Human    81 TLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK--------ETAFLYAISSAGLTHAL 137
                       .||..|:::||||..:     ..:::..|        |..::.|||.|.:.|.|
  Fly    50 -----------SCQQSFQWQRWNCPSQ-----DFVQKNSKPEENSPNREDVYVAAISMAAIVHTL 98

Human   138 AKACSAGRMERCTCDE-----------APDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDL 191
            .|.|:.|.:..|.|.|           ...||..|.....|.|            .:|       
  Fly    99 TKDCANGVIAGCGCTENALNVPCAHEPTKALEQYEKHFGSGSG------------AIG------- 144

Human   192 RARVDFHNNLVGVKVIKAGVETTCKCH---GVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKV 253
                  ||..|...:::..:|..|:|.   .|.|.|....|...|.||..:.:.|...|:.|:::
  Fly   145 ------HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL 203

Human   254 -GSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFC---LAGRFSPGTAGRRCH 314
             |:::|               ......:.||   ..||.:.|||::|   ..|.:. ||.||:|.
  Fly   204 EGASSN---------------LKIMWQNIPL---DSLVFMQDSPNYCERDATGLWK-GTRGRQCS 249

Human   315 RE--------KNCESIC--CGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTC 363
            ::        .:|:.:|  ||....:|.....|.|.|::.|...::|..|.|.|..|:|
  Fly   250 KDGSGSLEERLSCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 74/336 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 2/26 (8%)
wntDNP_650272.1 wnt 41..308 CDD:302926 75/346 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.