DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9A and Wnt10

DIOPT Version :9

Sequence 1:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:405 Identity:124/405 - (30%)
Similarity:189/405 - (46%) Gaps:109/405 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    64 LERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNC-TLEGRYR----ASLLKRGFKETA 123
            |.:.|..:|.:...|....:|.:.|:..|||.||::.|||| :|..:.|    :||||:|::|:|
  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146

Human   124 FLYAISSAGLTHALAKACSAGRMERCTCD-------------EAPDLENRE-------------- 161
            |.:|||:||:.|::|:|||.||:..|.||             ::.|.|.::              
  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211

Human   162 ------------AWQWGGCGDNLKYSSKFVKEFLG-RRSSKDLRARVDFHNNLVGVKVIKAGVET 213
                        .|:||||..|:.:..::.|.||. |..:.|::::::.|||..|...:...:|.
  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276

Human   214 TCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGST------------------TNEA 260
            .|||||:||||.::|||:....||.|||.|||::..|:.|..:                  :|..
  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341

Human   261 AGEAGAISPPRGRASGAGGSDP-------------------------------LPRTPE--LVHL 292
            :| :|:.||.......:||.|.                               :.|..|  |.:.
  Fly   342 SG-SGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYY 405

Human   293 DDSPSFCL--AGRFSPGTAGRRCHR----EKNCESICCGRGHNTQSRVVTR---PCQCQVRWCCY 348
            ..||:||.  .|....||.||:|:|    ...|.|:||||||   |:|:.|   .|.|:.:|||.
  Fly   406 QRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGH---SQVIQRRAERCHCKFQWCCN 467

Human   349 VECRQCTQREEVYTC 363
            |||.:|...|.:..|
  Fly   468 VECEECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 124/405 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 8/57 (14%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 116/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152271
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.