DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9A and Wnt6

DIOPT Version :9

Sequence 1:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:454 Identity:128/454 - (28%)
Similarity:191/454 - (42%) Gaps:144/454 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    17 LTLLLAALRPSAAYFGLTGSEPLTILPLTLEPEAAAQAHYKACDRL-KLERKQRRMCRRDPG-VA 79
            |.:::|.|..:....|...:|...||   |:|..       .|.:. :|..|...:||.|.. :.
  Fly     3 LLMVIAILIFAMPMTGFGWAEGTNIL---LDPNL-------MCKKTRRLRGKLAEICRHDSALLK 57

Human    80 ETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAG 144
            |.::..:::...||:||||..|||||:..:....:|.|..:||.|:.||::||:|:|:.|||:.|
  Fly    58 EIIINGINLGFRECEFQFRNRRWNCTVLRKSMRKILMRDSRETGFVNAITAAGVTYAVTKACTMG 122

Human   145 RMERCTCDEA--------PDL-------------------------------------------- 157
            ::..|:||:|        |.:                                            
  Fly   123 QLVECSCDKAHMRRNGGQPQMVTAATAEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNNASTMT 187

Human   158 ----------ENRE-------------------AWQWGGCGDNLKYSSKFVKEFLG---RRSSKD 190
                      .||.                   .|:||||.||:.:..:..:.||.   |:...|
  Fly   188 DIAPVEHRGGRNRRPGGRRGRRKFWDNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSD 252

Human   191 LRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGS 255
            |...|.||||..|...|:..:...|||||:||||||:|||.::.||.||...|:.:|::|.|| :
  Fly   253 LGTLVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKV-T 316

Human   256 TTNEAAGEAGAISPPRGRASGAGGSDPLPRTP--------ELVHLDDSPSFCLAGRFSP------ 306
            ..|:                   |:..:|.:|        :||..||||.||     :|      
  Fly   317 LRND-------------------GNSFMPESPHARPANKYQLVFADDSPDFC-----TPNSKTGA 357

Human   307 -GTAGRRCH----REKNCESICCGRGHNTQSRVVTRP--CQCQVRWCCYVECRQCTQREEVYTC 363
             ||.||.|:    ....|:.:||.|||.  .|:|...  |:|..:|||.|.|.:|.:...|.||
  Fly   358 LGTQGRECNVTSSGSDRCDRLCCNRGHT--RRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 118/406 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 2/26 (8%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 116/404 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.