DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT9A and Wnt5

DIOPT Version :9

Sequence 1:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:467 Identity:115/467 - (24%)
Similarity:174/467 - (37%) Gaps:182/467 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    64 LERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNC--TLEGRYRASLLKRGFKETAFLY 126
            |...|::.|.:...|...:......:..||||||:..||||  |.:......:......|.||::
  Fly   554 LSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAAPEMAFIH 618

Human   127 AISSAGLTHALAKACSAGRMERCTCDE-APDLENREAWQWGGCGDNLKYSSKFVKEFLGRR---- 186
            |:::|.:|..:|:||..|::..|:|.. :...:..:.|:||||||||:::.||..:|:..|    
  Fly   619 ALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHDDWKWGGCGDNLEFAYKFATDFIDSREKET 683

Human   187 ----------------------------------------------------------------- 186
                                                                             
  Fly   684 NRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNEN 748

Human   187 ----------------------------------------------------------------- 186
                                                                             
  Fly   749 FDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPA 813

Human   187 --------SSKD------------LRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWR 231
                    |.||            .|:.::.|||..|.:.:......|||||||||||::.|||:
  Fly   814 YPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQ 878

Human   232 QLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSP 296
            ||:...|:|.:|:.|||.|.||  ..|:           |||.........:|...:|::||:||
  Fly   879 QLSSIREIGDYLREKYEGATKV--KINK-----------RGRLQIKDLQFKVPTAHDLIYLDESP 930

Human   297 SFCLAGRFS-----PGTAGRRCHRE----KNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECR 352
            .:|   |.|     |||.||.||:.    ::|..:|||||:||::.:|...|.|:..|||.|:|.
  Fly   931 DWC---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCE 992

Human   353 QCTQREEVYTCK 364
            .||:..|.:|||
  Fly   993 VCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 113/465 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 4/26 (15%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 113/465 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152270
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.