DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT2B and Wnt10

DIOPT Version :9

Sequence 1:NP_078613.1 Gene:WNT2B / 7482 HGNCID:12781 Length:391 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:472 Identity:148/472 - (31%)
Similarity:206/472 - (43%) Gaps:120/472 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     9 EAAQLPLRRASAPVPVPSPAAPDGSR---ASARLGLACLLLLLLLTLPARVDTSWWYIGALGARV 70
            |..|||.::........|.::...|.   |:......|.|.|:::.:.| ..|.|.| |....|.
  Fly    12 EQQQLPQQQKQQQEAGSSSSSNSSSNNLVATPATSRHCNLHLIVMIILA-CCTRWLY-GLPDGRA 74

Human    71 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLD----RDHTVFGRV 131
            .|.::|||...|.:||.:..|:..:..||....|||||.||:.|||||::|.    ..|.  ..:
  Fly    75 TCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA--SSL 137

Human   132 MLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDP-------------------------- 170
            :.:..||:||.:|||:|||.|::.||||||.|..|.|||                          
  Fly   138 LKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYL 202

Human   171 -------------YTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNN 222
                         |.|.:...:   :.|||||.|:.:||.::|.|:|.:|| ..|.::.:|||||
  Fly   203 ETNQILTPEEEKKYERSKIASR---WKWGGCSHNMDFGVEYSKLFLDCREK-AGDIQSKINLHNN 263

Human   223 RCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFR---------------------------- 259
            ..||.||...::..|||||:||||.|:|||::..||.                            
  Fly   264 HAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVV 328

Human   260 -----------------------------------RTGDYLRRRYDG-AVQVMATQDGANFTAAR 288
                                               .|||...||:|. .|:....|..|:..|||
  Fly   329 VLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAAR 393

Human   289 QGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVT 353
            ..  |...|.|.|:..||::|..|..|...||.||.|::.:..:|||..:|||||:......|..
  Fly   394 MA--RKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAE 456

Human   354 QCECKFHWCCAVRCKEC 370
            :|.|||.|||.|.|:||
  Fly   457 RCHCKFQWCCNVECEEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT2BNP_078613.1 wnt 74..380 CDD:306592 131/404 (32%)
WNT-core domain 107..379 119/371 (32%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 123/391 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.