DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT10B and Wnt6

DIOPT Version :9

Sequence 1:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens
Sequence 2:NP_001260188.1 Gene:Wnt6 / 34010 FlyBaseID:FBgn0031902 Length:420 Species:Drosophila melanogaster


Alignment Length:407 Identity:136/407 - (33%)
Similarity:194/407 - (47%) Gaps:76/407 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    42 LTANTVCLTLSGLSKRQLGLCLRNPDVTASAL------QGLHIAVHECQHQLRDQRWNCSALEGG 100
            |..|.:|.....|..:...:|..:     |||      .|:::...||:.|.|::||||:.|...
  Fly    29 LDPNLMCKKTRRLRGKLAEICRHD-----SALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKS 88

Human   101 GRLPHHSAILKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCG---WKGSGEQDRL----- 157
            .|     .||.|..||:.|..::.||||.:||..||::|:||.|.|.   .:.:|.|.::     
  Fly    89 MR-----KILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSCDKAHMRRNGGQPQMVTAAT 148

Human   158 ---------RAKLLQ----------LQALSRGKSFPHSLPSPGP-----GSSPSPG--------- 189
                     :|.:|:          .|.|||..: ..::....|     |.:..||         
  Fly   149 AEAALERQQQAAMLRQQMPLQDQHPSQRLSRMNN-ASTMTDIAPVEHRGGRNRRPGGRRGRRKFW 212

Human   190 -----PQDTWEWGGCNHDMDFGEKFSRDFLDSREAPR--DIQARMRIHNNRVGRQVVTENLKRKC 247
                 |:..||||||:.:::||.:.||.|||:::..|  |:...::.|||..||..:.:.::.:|
  Fly   213 DNIKFPEGQWEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGTLVKFHNNNAGRLAIRDAMRLEC 277

Human   248 KCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAF---QPRLRPRRLSGELV 309
            ||||.||||..||||...|.||.|...||:|...|..:...| :..:|   .|..||.. ..:||
  Fly   278 KCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRN-DGNSFMPESPHARPAN-KYQLV 340

Human   310 YFEKSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHN---VLRQTRVERCHCRFHWC 371
            :.:.|||||..:...|:.||:||.||.||...|.|..|||.|||.   |..||   .|.|.|.||
  Fly   341 FADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQT---NCKCVFKWC 402

Human   372 CYVLCDECKVTEWVNVC 388
            |.|.|::|.....||.|
  Fly   403 CEVTCEKCLEHRAVNTC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 135/404 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 7/44 (16%)
Wnt6NP_001260188.1 wnt 41..419 CDD:278536 132/393 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.