DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT10B and Wnt5

DIOPT Version :9

Sequence 1:NP_003385.2 Gene:WNT10B / 7480 HGNCID:12775 Length:389 Species:Homo sapiens
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:505 Identity:128/505 - (25%)
Similarity:178/505 - (35%) Gaps:211/505 - (41%)


- Green bases have known domain annotations that are detailed below.


Human    48 CLTLSGLSKRQLGLCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGG---GRLPHHSAI 109
            |.:..|||..|...|:::..|..:..:|...|:.|||.|.:::|||||.....   |.:...:| 
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTNDETVFGPMTSLAA- 611

Human   110 LKRGFRESAFSFSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFP 174
                 .|.||..::.||.|...:|.||..|:|.||.|                     ||| |.|
  Fly   612 -----PEMAFIHALAAATVTSFIARACRDGQLASCSC---------------------SRG-SRP 649

Human   175 HSLPSPGPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREA-------------------- 219
            ..|             .|.|:||||..:::|..||:.||:||||.                    
  Fly   650 KQL-------------HDDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNR 701

Human   220 ----------------------------------------------------------------- 219
                                                                             
  Fly   702 MHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILT 766

Human   220 ------------------------------------------------PRD-------------- 222
                                                            ||:              
  Fly   767 SKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPR 831

Human   223 ----IQAR--MRIHNNRVGRQVVTENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGR 281
                ::||  |.:|||..||:.|.:..:..|||||.||||...|||:.....|.:|..|||:...
  Fly   832 STATVKARSLMNLHNNEAGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEG 896

Human   282 AIFIDTHNRNSGAFQPRLRPRRL------SGELVYFEKSPDFCERDPTMGSPGTRGRACNKTSRL 340
            |..:..:.|.      ||:.:.|      :.:|:|.::|||:|.....:..|||.||.|:|.|..
  Fly   897 ATKVKINKRG------RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSG 955

Human   341 LDGCGSLCCGRGHNVLRQTRVERCHCRFHWCCYVLCDEC-KVTEWVNVCK 389
            |:.|..||||||:|.......|||:|:|||||.|.|:.| ||.| .:.||
  Fly   956 LESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKCEVCTKVLE-EHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT10BNP_003385.2 Wnt_Wnt10b 45..389 CDD:381730 126/503 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..197 5/25 (20%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 124/497 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.