DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT8B and wntD

DIOPT Version :9

Sequence 1:NP_003384.2 Gene:WNT8B / 7479 HGNCID:12789 Length:351 Species:Homo sapiens
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:308 Identity:88/308 - (28%)
Similarity:142/308 - (46%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    34 KAYLIYSSSVAAGAQSGIEECKYQFAWDRWNCPER-ALQLSSHGGLRSANRETAFVHAISSAGVM 97
            :|.|.:......|.:..::.|:..|.|.|||||.: .:|.:|.....|.|||..:|.|||.|.::
  Fly    31 QAPLSWEDITGKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIV 95

Human    98 YTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISK---QFVDALETGQDARAA 159
            :|||::|:.|....|||.::               :.||......:|   |:.....:|..|.. 
  Fly    96 HTLTKDCANGVIAGCGCTEN---------------ALNVPCAHEPTKALEQYEKHFGSGSGAIG- 144

Human   160 MNLHNNEAGRKAVKGTMKRTCKCH---GVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLL 221
               ||.......::.::::.|:|.   .|.|.|..:.|...|..|..:...|.:.|..|::   |
  Fly   145 ---HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQ---L 203

Human   222 QGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGL-LGTEGRECLRRGRALGRWERR 285
            :||.::      :...:::|....||.::|||:|| |....|| .||.||:|.:.|.. ...||.
  Fly   204 EGASSN------LKIMWQNIPLDSLVFMQDSPNYC-ERDATGLWKGTRGRQCSKDGSG-SLEERL 260

Human   286 SCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFC 333
            ||::||..||..|..:...|...||||..|...::|:.|.:...:|.|
  Fly   261 SCQQLCRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT8BNP_003384.2 WNT1 23..333 CDD:128408 87/306 (28%)
wntDNP_650272.1 wnt 41..308 CDD:302926 85/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D278331at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.