DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT8A and Wnt10

DIOPT Version :9

Sequence 1:XP_016865313.1 Gene:WNT8A / 7478 HGNCID:12788 Length:408 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:409 Identity:129/409 - (31%)
Similarity:181/409 - (44%) Gaps:123/409 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    70 ITGPKAYLTY----TTSVAL-GAQSGIEECKFQFAWERWNCPENALQLSTHNR-------LRSAT 122
            :|..:..|.|    .|:.|| |....|.||:.||.|.||||.    .|||.:|       |:...
  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCS----SLSTKSRNPHASSLLKKGY 142

Human   123 RETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSNNGKTGGHG--------------------- 166
            ||::|..|||:|||.:.:.:.||.|...:||||.:.|.||....                     
  Fly   143 RESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQI 207

Human   167 -----------------WIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRA 214
                             |.|||||.|::||...||||:|..||..|.::.:|||||.|||:||..
  Fly   208 LTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSN 272

Human   215 TMKRTCKCHGISGSCSIQTCWLQLAEFREMGDYLKAKYDQALKIEMD-----------KR----- 263
            .|:..|||||:||||.::|||....:|..:|..||.::.:|:.::..           ||     
  Fly   273 NMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKK 337

Human   264 ------------QLRAGNSAEGH----------------WVPAEAFLPSA-----------EAEL 289
                        .|.:.:::.||                .|......|||           |..|
  Fly   338 SNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSL 402

Human   290 IFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECG---LQVEERKTEVISS 351
            .:.:.||::|..:....|.||.||:|.:|:..:.     .|..||  ||   .||.:|:.|   .
  Fly   403 FYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSD-----GCTSLC--CGRGHSQVIQRRAE---R 457

Human   352 CNCKFQWCCTVKCDQCRHV 370
            |:|||||||.|:|::| ||
  Fly   458 CHCKFQWCCNVECEEC-HV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT8AXP_016865313.1 None
Wnt10NP_609109.3 wnt 82..466 CDD:278536 122/397 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.