DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT7B and Wnt10

DIOPT Version :9

Sequence 1:XP_011528668.1 Gene:WNT7B / 7477 HGNCID:12787 Length:353 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:409 Identity:138/409 - (33%)
Similarity:194/409 - (47%) Gaps:100/409 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    42 CNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKT---VFGQELRV 103
            |..:|||...|..:|....|......||..|.|.|||.||::.|||||:|..|:   .....|:.
  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140

Human   104 GSREAAFTYAITAAGVAHAVTAACSQGNLSNCGC-----------------DREKQGYY-----N 146
            |.||:||.:||:||||||:|..|||||.|.:|||                 |:||:.:.     |
  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETN 205

Human   147 Q---------------AEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVL 196
            |               |..|||||||.::.:|:::|:.|:|.||...:.:..:|||||.|||..:
  Fly   206 QILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAV 270

Human   197 EDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVE-----------VVRASR- 249
            .:.|:..|||||:||||..||||.:.|.|..||.:||.::..|:.|:           |::.:| 
  Fly   271 SNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARN 335

Human   250 ----------------------------------------------LRQPTFLRIKQLRSYQKPM 268
                                                          .|||:  ..|......:.:
  Fly   336 KKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPS--ADKNAARMARKL 398

Human   269 ETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFH 333
            ||.|.|.::|||:||.|......||.||.|||.:..:|||.::|||||::.....:..:|:|||.
  Fly   399 ETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQ 463

Human   334 WCCFVKCNTCSERTEVFTC 352
            |||.|:|..|.....:..|
  Fly   464 WCCNVECEECHVEEWISIC 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT7BXP_011528668.1 wnt_Wnt7b 36..353 CDD:381724 138/409 (34%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 129/385 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.