DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT5A and wntD

DIOPT Version :9

Sequence 1:XP_016862616.1 Gene:WNT5A / 7474 HGNCID:12784 Length:394 Species:Homo sapiens
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:298 Identity:80/298 - (26%)
Similarity:131/298 - (43%) Gaps:42/298 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   108 GEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIG-SRETAFTYAVSAAGVVNAMSRACREG 171
            |:|.|..:..||..|:.:||||.:.|......:..:.. :||..:..|:|.|.:|:.:::.|..|
  Fly    41 GKGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENSPNREDVYVAAISMAAIVHTLTKDCANG 105

Human   172 ELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARER-ERIHAKGSYESARILMNLH 235
            .::.|||:..|  .::|       |          |.|...|.|: |:....||....      |
  Fly   106 VIAGCGCTENA--LNVP-------C----------AHEPTKALEQYEKHFGSGSGAIG------H 145

Human   236 NNEAGRRTVYNLADVACKCH---GVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMR-LNSRG 296
            |.......:....:..|:|.   .|.|.|..:.|...|..|..:...|.:.||.|..:. .:|..
  Fly   146 NRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLEGASSNL 210

Human   297 KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEG----MDGCELMCCGRG 357
            |::..|...:|     ||::..||:||.|:.:....||:||.|:|...|    ...|:.:|...|
  Fly   211 KIMWQNIPLDS-----LVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCG 270

Human   358 YD-QFKTVQTE-RCHCKFHWCCYVKCKKCTEIVDQFVC 393
            |. :.:.|:|| ||:||..|...::|..|.::..|:.|
  Fly   271 YRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT5AXP_016862616.1 None
wntDNP_650272.1 wnt 41..308 CDD:302926 79/296 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.