DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT2 and wntD

DIOPT Version :9

Sequence 1:NP_003382.1 Gene:WNT2 / 7472 HGNCID:12780 Length:360 Species:Homo sapiens
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:303 Identity:78/303 - (25%)
Similarity:126/303 - (41%) Gaps:57/303 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    67 QGVAEWTAECQHQFRQHRWNC--------NTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAI 123
            :|:.:....||..|:..||||        |:...::|        .:||..:|.|||.|.:|..:
  Fly    42 KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENS--------PNREDVYVAAISMAAIVHTL 98

Human   124 TRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNL 188
            |:.|:.|.:..|.|....:                 |:....:..:|....::..|..:.|:.  
  Fly    99 TKDCANGVIAGCGCTENAL-----------------NVPCAHEPTKALEQYEKHFGSGSGAIG-- 144

Human   189 HNNRAGRKAVKRFLKQECKCH---GVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDG 250
            ||.|.....::|.|:|||:|.   .|.|.|....|...:..|......|.:.|:.|||:    :|
  Fly   145 HNRRVVGALLQRSLEQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQL----EG 205

Human   251 TGFTVANERFKKPTKN----DLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG----MDSCEVM 307
                 |:...|...:|    .||:.::||:||.||......||.||.|:....|    ..||:.:
  Fly   206 -----ASSNLKIMWQNIPLDSLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQL 265

Human   308 C--CGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTC 348
            |  ||....:.||....:|.||..|...::|..|::....::|
  Fly   266 CRVCGYRVRSQHVRTERRCNCKLVWGFRLQCDVCVQLERQYSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT2NP_003382.1 wnt 43..349 CDD:306592 78/303 (26%)
wntDNP_650272.1 wnt 41..308 CDD:302926 77/301 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.