DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT2 and Wnt5

DIOPT Version :9

Sequence 1:NP_003382.1 Gene:WNT2 / 7472 HGNCID:12780 Length:360 Species:Homo sapiens
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:468 Identity:147/468 - (31%)
Similarity:210/468 - (44%) Gaps:170/468 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    41 CDNVPGLVSSQRQLCHRHPDVMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSS 105
            |.:..||.:||::.|.:|..||.|||:|......|||.||:..||||:|.: |.::||.:...::
  Fly   548 CYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRWNCSTTN-DETVFGPMTSLAA 611

Human   106 RESAFVYAISSAGVVFAITRACSQGEVKSCSCD----PKKMGSAKDSKGIFDWGGCSDNIDYGIK 166
            .|.||::|:::|.|...|.|||..|::.||||.    ||::..  |.|    ||||.||:::..|
  Fly   612 PEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSRPKQLHD--DWK----WGGCGDNLEFAYK 670

Human   167 FARAFVDAKER------------------------------------------------------ 177
            ||..|:|::|:                                                      
  Fly   671 FATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNKNVDAKNDTSLVVRNVRK 735

Human   178 --------------------------------------------------------KG------- 179
                                                                    ||       
  Fly   736 STEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQEIVNTKFFKGEQQPRKK 800

Human   180 -----------------------KD------------ARALMNLHNNRAGRKAVKRFLKQECKCH 209
                                   ||            ||:|||||||.|||:||.:..:..||||
  Fly   801 KRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNEAGRRAVIKKARITCKCH 865

Human   210 GVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANERFKKPTKNDLVYFENS 274
            ||||||:|.|||..::..|:.||||..||.||.:|.:|:.|. ..:.:.:||.||.:||:|.:.|
  Fly   866 GVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRGR-LQIKDLQFKVPTAHDLIYLDES 929

Human   275 PDYCIRDREAGSL---GTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRC 336
            ||:|   |.:.:|   ||.||||:..|.|::||.::||||||:|.::....:|.|||||||.|:|
  Fly   930 PDWC---RNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGYNTKNIIVNERCNCKFHWCCQVKC 991

Human   337 QDCLEALDVHTCK 349
            :.|.:.|:.||||
  Fly   992 EVCTKVLEEHTCK 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT2NP_003382.1 wnt 43..349 CDD:306592 144/464 (31%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 143/460 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152279
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X108
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.