DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT1 and Wnt10

DIOPT Version :9

Sequence 1:NP_005421.1 Gene:WNT1 / 7471 HGNCID:12774 Length:370 Species:Homo sapiens
Sequence 2:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster


Alignment Length:394 Identity:132/394 - (33%)
Similarity:173/394 - (43%) Gaps:99/394 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    64 LSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPT----APGPHLFGKIVNRGCRET 124
            |::.|..|..:...:..:...||..|:|||:.||:..||||.:    :..||. ..::.:|.||:
  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA-SSLLKKGYRES 145

Human   125 AFIFAITSAGVTHSVARSCSEGSIESCTCD----------------------------------- 154
            ||.|||::|||.|||||:||:|.:.||.||                                   
  Fly   146 AFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTP 210

Human   155 -----YRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEM 214
                 | .|......|.|||||.|:|||..:.:.|:|..||..|::..:|||||.|||..|.:.|
  Fly   211 EEEKKY-ERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNM 274

Human   215 RQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGA-------------------SRVLYGN 260
            ...||||||||||.::|||...|....||.||:.:|..|                   :|....|
  Fly   275 EFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSN 339

Human   261 RGSNRASRAELLRLEPEDPAH----------------------KPPSPH------------DLVY 291
            .||...|.:..|........|                      :.||..            .|.|
  Fly   340 GGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFY 404

Human   292 FEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVS 356
            :::|||||.........||.||.||.::...|||..|||||||....||..|||:|.|.|||:|.
  Fly   405 YQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVE 469

Human   357 CRNC 360
            |..|
  Fly   470 CEEC 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT1NP_005421.1 Wnt_Wnt1 64..370 CDD:381707 132/394 (34%)
Wnt10NP_609109.3 wnt 82..466 CDD:278536 127/385 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.