DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment WNT1 and Wnt5

DIOPT Version :9

Sequence 1:NP_005421.1 Gene:WNT1 / 7471 HGNCID:12774 Length:370 Species:Homo sapiens
Sequence 2:NP_001285407.1 Gene:Wnt5 / 32838 FlyBaseID:FBgn0010194 Length:1004 Species:Drosophila melanogaster


Alignment Length:490 Identity:140/490 - (28%)
Similarity:201/490 - (41%) Gaps:176/490 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    42 SSTNLLTDSKSLQLVLEP----SLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRW 102
            :.|....|:.|..:.|.|    |...||..|::...::..::.::|.|.::|::||::||:||||
  Fly   528 NDTTPTADAYSETIDLNPNNCYSAIGLSNSQKKQCVKHTSVMPAISRGARAAIQECQFQFKNRRW 592

Human   103 NCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGP---- 163
            ||.|.....:||.:.:....|.|||.|:.:|.||..:||:|.:|.:.||:|....|    |    
  Fly   593 NCSTTNDETVFGPMTSLAAPEMAFIHALAAATVTSFIARACRDGQLASCSCSRGSR----PKQLH 653

Human   164 -DWHWGGCSDNIDFGRLFGREFVDSGEKGRD---------------------------------- 193
             ||.||||.||::|...|..:|:||.||..:                                  
  Fly   654 DDWKWGGCGDNLEFAYKFATDFIDSREKETNRETRGVKRKREEINKNRMHSDDTNAFNIGIKRNK 718

Human   194 ----------------------------------------------------------------- 193
                                                                             
  Fly   719 NVDAKNDTSLVVRNVRKSTEAENSHILNENFDQHLLELEQRITKEILTSKIDEEEMIKLQEKIKQ 783

Human   194 ------------------------------------------------------LRFLMNLHNNE 204
                                                                  .|.||||||||
  Fly   784 EIVNTKFFKGEQQPRKKKRKNQRAAADAPAYPRNGIKESYKDGGILPRSTATVKARSLMNLHNNE 848

Human   205 AGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRA 269
            |||..|..:.|..|||||:||||::.|||.:|.::|.:||.||::::||::|....||       
  Fly   849 AGRRAVIKKARITCKCHGVSGSCSLITCWQQLSSIREIGDYLREKYEGATKVKINKRG------- 906

Human   270 ELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGH 334
               ||:.:|...|.|:.|||:|.::||::|..|..|...||.||.|:.:|..|:.|.:||||||:
  Fly   907 ---RLQIKDLQFKVPTAHDLIYLDESPDWCRNSYALHWPGTHGRVCHKNSSGLESCAILCCGRGY 968

Human   335 RTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHEC 369
            .|:...|.|||||.|||||.|.|..||.....|.|
  Fly   969 NTKNIIVNERCNCKFHWCCQVKCEVCTKVLEEHTC 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
WNT1NP_005421.1 Wnt_Wnt1 64..370 CDD:381707 134/464 (29%)
Wnt5NP_001285407.1 wnt 554..1004 CDD:278536 134/464 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.