DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF4H and CG3594

DIOPT Version :10

Sequence 1:NP_071496.1 Gene:EIF4H / 7458 HGNCID:12741 Length:248 Species:Homo sapiens
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:81 Identity:22/81 - (27%)
Similarity:42/81 - (51%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    42 YTAYVGNLPFNTVQGDIDAIFKDL-SIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGAL 105
            :..||.||.|.|.:.|::..|... :::|:|:.:.:.    .||.:||..::.|.:.|.......
  Fly   114 HVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPKKRR----GGFAFVEMADLSSFQNAFQLHNTE 174

Human   106 LGDRSLRVDIAEGRKQ 121
            |..|:::|.|:|..|:
  Fly   175 LQGRNIKVQISEAGKK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EIF4HNP_071496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
RRM_eIF4H 37..120 CDD:409835 21/78 (27%)
SF-CC1 <40..>227 CDD:273721 22/81 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 0/1 (0%)
HHV-1 Vhs binding site 137..157
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 22/81 (27%)
RRM 116..187 CDD:440488 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.