DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EIF4H and Pabp2

DIOPT Version :10

Sequence 1:NP_071496.1 Gene:EIF4H / 7458 HGNCID:12741 Length:248 Species:Homo sapiens
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:158 Identity:40/158 - (25%)
Similarity:66/158 - (41%) Gaps:35/158 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    33 QKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDL-SIRSVRLVRDKDTDKFKGFCYVEFDEVDSLK 96
            ::|:.|.   :.||||:.:.....:::|.|... :|..|.::.:|.....|||.|:||...:.::
  Fly    90 KQEIDTR---SVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVE 151

Human    97 EALTYDGALLGDRSLRVDIAEGRKQDKGGFG----FRKGGPDDRGMGSSRESRGGWDSRDDFNSG 157
            .||..:..|...|.::|   ..::.::.|..    |.:|         |...||...||...:|.
  Fly   152 TALAMNETLFRGRQIKV---MSKRTNRPGLSTTNRFARG---------SFRGRGARVSRACCHST 204

Human   158 FRDDFLGGRGGSRPGDRRTGPPMGSRFR 185
            ||            |.||.   ||.|.|
  Fly   205 FR------------GARRA---MGYRGR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EIF4HNP_071496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 2/7 (29%)
RRM_eIF4H 37..120 CDD:409835 21/83 (25%)
SF-CC1 <40..>227 CDD:273721 38/151 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 18/69 (26%)
HHV-1 Vhs binding site 137..157 5/19 (26%)
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.