DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VRK2 and dco

DIOPT Version :9

Sequence 1:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens
Sequence 2:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster


Alignment Length:392 Identity:119/392 - (30%)
Similarity:184/392 - (46%) Gaps:51/392 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    26 GNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVE--YQENGPLFSELKFYQRVAKKDCIKK 88
            ||::.||:|||||.||.|||....|..|:.|   :|:|  ..::..|..|.|||:.:.       
  Fly     6 GNKYRLGRKIGSGSFGDIYLGTTINTGEEVA---IKLECIRTKHPQLHIESKFYKTMQ------- 60

Human    89 WIERKQLDYLGIP--LFYGSGLTEFKGRSYRFMVMERLGIDLQKI-SGQNGTFKKSTVLQLGIRM 150
                   ..:|||  ::.||     :| .|..||||.||..|:.: :..:..|...|||.|..:|
  Fly    61 -------GGIGIPRIIWCGS-----EG-DYNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQM 112

Human   151 LDVLEYIHENEYVHGDIKAANLLLGY-KNPDQVYLADYGLS--YRYCPNGNHKQYQENPRKGHNG 212
            :..::|||..:::|.|||..|.|:|. |..:.||:.|:||:  :|...:..|..|:||  |...|
  Fly   113 ISRIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYREN--KNLTG 175

Human   213 TIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDE--LPQSV 275
            |..:.|::.|.|:..|||.|:|.|||.::.:..|.||| |.||  .|.:..|...:.|  |..|:
  Fly   176 TARYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPW-QGLK--AANKRQKYERISEKKLSTSI 237

Human   276 L---KWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLG-PLDFSTKGQSINVHT 336
            :   |..||     |...:|.....:.:|::|:|..|:|:.......|| ..|:......:....
  Fly   238 VVLCKGFPS-----EFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGG 297

Human   337 P-NSQKV-DSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRR 399
            | |.|.: .:|..|..|.  .|:.:......:..:|.|....:..|....:|.....|||:..:.
  Fly   298 PRNPQAIQQAQDGADGQA--GHDAVAAAAAVAAAAAASSHQQQQHKVNAALGGGGGSAAQQQLQG 360

Human   400 RQ 401
            .|
  Fly   361 GQ 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 101/300 (34%)
SPS1 29..421 CDD:223589 117/389 (30%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508 1/5 (20%)
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 100/306 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.