DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VRK2 and ball

DIOPT Version :9

Sequence 1:NP_001123952.1 Gene:VRK2 / 7444 HGNCID:12719 Length:508 Species:Homo sapiens
Sequence 2:NP_651508.1 Gene:ball / 43228 FlyBaseID:FBgn0027889 Length:599 Species:Drosophila melanogaster


Alignment Length:462 Identity:168/462 - (36%)
Similarity:244/462 - (52%) Gaps:46/462 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     5 RNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGP 69
            :::.||:|....||.|..|:...||.:|..||.||||.||.|....:...||  |||.|...|||
  Fly    23 KSKLYKMPEKVKEGTVFTDLAKGQWRIGPSIGVGGFGEIYAACKVGEKNYDA--VVKCEPHGNGP 85

Human    70 LFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQ 134
            ||.|:.||.|.||.:.||:::::..|..||:|....:|..|..|..:||:||.|.|.||.|...|
  Fly    86 LFVEMHFYLRNAKLEDIKQFMQKHGLKSLGMPYILANGSVEVNGEKHRFIVMPRYGSDLTKFLEQ 150

Human   135 NG-TFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYK--NPDQVYLADYGLSYRYCPN 196
            || ...:.||.:|.|:||||.:|:|.|.|||.|:||||:|||.:  ...|.||.|:||:..:...
  Fly   151 NGKRLPEGTVYRLAIQMLDVYQYMHSNGYVHADLKAANILLGLEKGGAAQAYLVDFGLASHFVTG 215

Human   197 GNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPW--EQNLKDPVA 259
                .::.:|:|.||||||:||.|||.||. :||:|:|||||.::.||..:|||  ::.|..|..
  Fly   216 ----DFKPDPKKMHNGTIEYTSRDAHLGVP-TRRADLEILGYNLIEWLGAELPWVTQKLLAVPPK 275

Human   260 VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNY--------QALKKILNPH 316
            ||.||...:|.:.:|:....|.|.. ..|..|:.....|.::::|:|        .|||::..|:
  Fly   276 VQKAKEAFMDNIGESLKTLFPKGVP-PPIGDFMKYVSKLTHNQEPDYDKCRSWFSSALKQLKIPN 339

Human   317 GIPLGPLDFSTKGQSI---NVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKV 378
            .   |.|||..|.|:.   |:..|.:.|..:.:.|.|..:...|..:::|:.:....|       
  Fly   340 N---GDLDFKMKPQTSSNNNLSPPGTSKAATARKAKKIDSPVLNSSLDEKISASEDDE------- 394

Human   379 QKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEV-NSFP--QKISYTQFPNSFYEPHQDFTSPD 440
            ::|||   ....:.|::.|...:..:.|  ||..| :|.|  ||...|: |.|  .|.:..| |.
  Fly   395 EEEEK---SHRKKTAKKVTPSARNAKVS--PLKRVADSSPPSQKRVKTE-PKS--TPRERAT-PK 450

Human   441 IFKKSRS 447
            ...|.||
  Fly   451 ASPKPRS 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VRK2NP_001123952.1 STKc_VRK2 16..314 CDD:271025 128/310 (41%)
SPS1 29..421 CDD:223589 151/410 (37%)
Interaction with MAP3K7. /evidence=ECO:0000269|PubMed:17709393 397..508 18/54 (33%)
ballNP_651508.1 STKc_VRK 36..328 CDD:270917 124/299 (41%)
SPS1 47..432 CDD:223589 149/407 (37%)
Pol_alpha_B_N <399..>502 CDD:285602 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149474
Domainoid 1 1.000 157 1.000 Domainoid score I4156
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I3210
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 1 1.000 - - FOG0002984
OrthoInspector 1 1.000 - - otm40438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4687
SonicParanoid 1 1.000 - - X1730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.