DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VRK1 and Asator

DIOPT Version :9

Sequence 1:XP_006720310.1 Gene:VRK1 / 7443 HGNCID:12718 Length:420 Species:Homo sapiens
Sequence 2:NP_651924.2 Gene:Asator / 43794 FlyBaseID:FBgn0039908 Length:1349 Species:Drosophila melanogaster


Alignment Length:492 Identity:124/492 - (25%)
Similarity:199/492 - (40%) Gaps:140/492 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     2 PRVKAAQAGR---------QSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLA-DM 56
            ||.:.|.|.:         :.|.|....:....|.::    |:.|||...||.||||.||.. |:
  Fly   133 PRNQVAVAAKDGILVDVKAKESVKMTSEDLLQPGHVV----KERWKVVRKIGGGGFGEIYEGQDL 193

Human    57 NSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYL----GVPKYWGSG 117
            .:.|.|      .:|||               .|.:|:|:.| :....||.|    .|.::.|.|
  Fly   194 ITREQV------ALKVE---------------SARQPKQVLK-MEVAVLKKLQGKEHVCRFIGCG 236

Human   118 LHDKNGKSYRFMIMDRFGSDLQKIYEANAK-RFSRKTVLQLSLRILDILEYIHEHEYVHGDIKAS 181
            .:|:    :.:::|...|.:|.::..|..: .||..|.|:|.|:||..:|.||...::|.|||.|
  Fly   237 RNDR----FNYVVMQLQGKNLAELRRAQPRGAFSLSTTLRLGLQILKAIESIHSVGFLHRDIKPS 297

Human   182 NL---LLNYKNPDQVYLVDYGLAYRY--------CPEGVHKEYKEDPKRCHDGTIEFTSIDAHNG 235
            |.   .|.| |..:||::|:|||.:|        ||...         ....||:.:.||:||..
  Fly   298 NFSVGRLPY-NCRRVYMLDFGLARQYTTGTGEVRCPRAA---------AGFRGTVRYASINAHRN 352

Human   236 VAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIA 300
            ....|..||..|.|.:::::.|.|||. .:||.:.|..:|.:|...|..        |:.|.::.
  Fly   353 REMGRHDDLWSLFYMLVEFVNGQLPWR-KIKDKEQVGLTKEKYDHRILL--------KHLPSDLK 408

Human   301 KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDG-----KLDLSVVEN-------------- 346
            :::|.::.|.|.::|.|..|..:..:.:|..|.|:..     |:|.:.:.|              
  Fly   409 QFLEHIQSLTYGDRPDYAMLIGLFERCMKRRGVKESDPYDWEKVDSTAIGNISATGNPSIPIKSD 473

Human   347 ---GGLKAKTITK---------KRKKEIEE------------------------------SKEPG 369
               |.:...|:..         :::.|||.                              |.||.
  Fly   474 YMHGNITQMTVAASNASGTEYIRKRAEIETAHITATDPLNIKEKVDKNCNATSLAQPAKGSGEPM 538

Human   370 VEDTEWSNTQ--TEEAIQTRS--EESQGAIHRSMSQP 402
            |:....:|.|  |.:.:|.:|  ..||.||....|.|
  Fly   539 VQHGNAANNQNITSKGLQQQSTLTNSQVAIANIQSAP 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VRK1XP_006720310.1 STKc_VRK1 26..326 CDD:271024 92/316 (29%)
S_TKc 37..293 CDD:214567 82/272 (30%)
AsatorNP_651924.2 STKc_TTBK 172..433 CDD:270919 90/305 (30%)
S_TKc 173..414 CDD:214567 85/285 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.