DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VRK1 and dco

DIOPT Version :9

Sequence 1:XP_006720310.1 Gene:VRK1 / 7443 HGNCID:12718 Length:420 Species:Homo sapiens
Sequence 2:NP_001263132.1 Gene:dco / 43673 FlyBaseID:FBgn0002413 Length:440 Species:Drosophila melanogaster


Alignment Length:322 Identity:99/322 - (30%)
Similarity:157/322 - (48%) Gaps:41/322 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    36 EWKVGLPIGQGGFGCIYL-ADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKW 99
            ::::|..||.|.||.||| ..:|:.|.|.....|:....|.    |..|.|||      :.:|..
  Fly     8 KYRLGRKIGSGSFGDIYLGTTINTGEEVAIKLECIRTKHPQ----LHIESKFY------KTMQGG 62

Human   100 IRTRKLKYLGVPK-YWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILD 163
            |        |:|: .|.....|     |..|:|:..|..|:.::...::|||.||||.|:.:::.
  Fly    63 I--------GIPRIIWCGSEGD-----YNVMVMELLGPSLEDLFNFCSRRFSLKTVLLLADQMIS 114

Human   164 ILEYIHEHEYVHGDIKASNLLLNY-KNPDQVYLVDYGLA--YRYCPEGVHKEYKEDPKRCHDGTI 225
            .::|||..:::|.|||..|.|:.. |..:.||::|:|||  :|......|..|:|:...  .||.
  Fly   115 RIDYIHSRDFIHRDIKPDNFLMGLGKKGNLVYIIDFGLAKKFRDARSLKHIPYRENKNL--TGTA 177

Human   226 EFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWED----NLKDPKYVRDSKIRYRENIASLM 286
            .:.||:.|.|:..|||.|||.|||.::.:..|.|||:.    | |..||.|.|:.:...:|..| 
  Fly   178 RYASINTHLGIEQSRRDDLESLGYVLMYFNLGALPWQGLKAAN-KRQKYERISEKKLSTSIVVL- 240

Human   287 DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGG 348
              |   |..|.|...|:...:.:.:.::|.|.:||.:.......:|...|...|.::::.||
  Fly   241 --C---KGFPSEFVNYLNFCRQMHFDQRPDYCHLRKLFRNLFHRLGFTYDYVFDWNLLKFGG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VRK1XP_006720310.1 STKc_VRK1 26..326 CDD:271024 94/298 (32%)
S_TKc 37..293 CDD:214567 86/264 (33%)
dcoNP_001263132.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 94/305 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.