DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VRK1 and CkIalpha

DIOPT Version :9

Sequence 1:XP_006720310.1 Gene:VRK1 / 7443 HGNCID:12718 Length:420 Species:Homo sapiens
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:343 Identity:95/343 - (27%)
Similarity:162/343 - (47%) Gaps:49/343 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    36 EWKVGLPIGQGGFGCIYLA-DMNSSESVGSDAPCVVKVEPSD--NGPLFTELKFYQRAAKPEQIQ 97
            :::|...||.|.||.|||. .:.|.|.|      .:|:|.:.  :..|..|.|.|:..:..    
  Fly    19 KYRVIRKIGSGSFGDIYLGMSIQSGEEV------AIKMESAHARHPQLLYEAKLYRILSGG---- 73

Human    98 KWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRIL 162
                      :|.|:.    .|....|::..::||..|..|:.::....:.|:.||||.|..:::
  Fly    74 ----------VGFPRI----RHHGKEKNFNTLVMDLLGPSLEDLFNFCTRHFTIKTVLMLVDQMI 124

Human   163 DILEYIHEHEYVHGDIKASNLLLNY-KNPDQVYLVDYGLAYRYCPEGV--HKEYKEDPKRCHDGT 224
            ..|||||...::|.|||..|.|:.. ::.::::|:|:|||.::.....  |..|:||...  .||
  Fly   125 GRLEYIHLKCFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNL--TGT 187

Human   225 IEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWED---NLKDPKYVRDSKIRYRENIASLM 286
            ..:.||:||.|:..|||.|:|.|||.|:.:..|.|||:.   |.|..||.:.|:.:....|..| 
  Fly   188 ARYASINAHLGIEQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL- 251

Human   287 DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVE------ 345
              |   |..|.|.:.|:...:.|.:.|:|.|..||.:.....:.:..:.|...|.::::      
  Fly   252 --C---KGSPAEFSMYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYDYIYDWTMLKQKTHQG 311

Human   346 --NGGLKAKTITKKRKKE 361
              |..:..:.:.|.::|:
  Fly   312 QPNPAILLEQLDKDKEKQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VRK1XP_006720310.1 STKc_VRK1 26..326 CDD:271024 90/298 (30%)
S_TKc 37..293 CDD:214567 80/264 (30%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 90/296 (30%)
Pkinase_Tyr 23..284 CDD:285015 89/292 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.