DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VIM and ifd-2

DIOPT Version :9

Sequence 1:NP_003371.2 Gene:VIM / 7431 HGNCID:12692 Length:466 Species:Homo sapiens
Sequence 2:NP_508160.1 Gene:ifd-2 / 180430 WormBaseID:WBGene00002058 Length:443 Species:Caenorhabditis elegans


Alignment Length:474 Identity:99/474 - (20%)
Similarity:190/474 - (40%) Gaps:120/474 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    13 RMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGV 77
            |:...|..|....|.|:.:.|..           :||.:|.|      ||..::|:         
 Worm     9 RLQNHPALARIIESGRTNLPTGI-----------TTSGALSA------YAQNAAAI--------- 47

Human    78 RLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQG 142
                              .::.|..||||:.:||:|.|.|::||||||.||::|..::...:...
 Worm    48 ------------------IRDNREREKVEIADLNNRLARYVEKVRFLEAQNRVLENDIGVFRNAA 94

Human   143 ---KSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDN---LAEDIMRLREKLQEEMLQREEAEN 201
               ..|:...:|.|...|...|.:   :||::.....|   |..|::..::.|:.....|.:...
 Worm    95 HTHSERIAVYFESEKASLFTLVRE---NKAKISTAEQNIRKLEPDVISAKKNLESSFQLRVQTRE 156

Human   202 TLQSFRQ-----DVDNASLARL--DLERKVESLQEEIAFL----KKLH--------------EEE 241
            ..:|..:     :.:|:.:.||  |.|.:...:..||:.|    |::|              :|.
 Worm   157 DKRSQMKILSNLEAENSYIKRLTTDCEEEKSRVHSEISRLRSDIKRVHALRDKERSKHSSSSQEL 221

Human   242 IQELQAQIQEQHVQIDVDVSKP--------------DLTAALRDVRQQYESVAAKNLQEAEEWYK 292
            ::.|...|.:..:.|..::||.              :|.||::::|.::|..:....:..|:||.
 Worm   222 LKRLNGCISQHDIAIREEISKARRDTTNKNRDYFHNELHAAMKEIRDRFEKDSRAARKTWEDWYH 286

Human   293 SKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREM----EENFAV 353
            .|..::.:.:...:....||::|....|..|.....::...:..|:.|.:::.::    :||..:
 Worm   287 KKITEIKKGSESYSSIQNQAREEILRIRSIVNEFRGKLSDSETINQQLIKRIDDLHFQDKENLRL 351

Human   354 EAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNF 418
                ::..:...::.:..|:||..:...|...|:..::.|..||..||||:|..|          
 Worm   352 ----FEIALNEKENLVIKMREECTKLSVELDKLVENQINLRNEINHYRKLMENAE---------- 402

Human   419 SSLNLRETNLDSLPLVDTH 437
               :||.|       |.||
 Worm   403 ---HLRTT-------VQTH 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VIMNP_003371.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 5/18 (28%)
Head 2..95 13/81 (16%)
Filament_head 14..101 CDD:368088 12/86 (14%)
Coil 1A 96..131 18/34 (53%)
Filament 102..410 CDD:365827 79/356 (22%)
Linker 1 132..153 2/23 (9%)
Coil 1B 154..245 21/118 (18%)
Linker 12 246..268 5/35 (14%)
Coil 2 269..407 28/141 (20%)
[IL]-x-C-x-x-[DE] motif. /evidence=ECO:0000305|PubMed:25417112 326..329 0/2 (0%)
Tail 408..466 7/30 (23%)
ifd-2NP_508160.1 Filament 55..402 CDD:278467 78/353 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 181 1.000 Domainoid score I2296
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X62
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.