DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VHL and Vhl

DIOPT Version :9

Sequence 1:NP_000542.1 Gene:VHL / 7428 HGNCID:12687 Length:213 Species:Homo sapiens
Sequence 2:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster


Alignment Length:138 Identity:35/138 - (25%)
Similarity:58/138 - (42%) Gaps:30/138 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    67 NSREPSQ------------VIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLF 119
            |:|:..|            |:|.|.:.|.:...|:........|.||.|....|::::..|.|||
  Fly     8 NNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLF 72

Human   120 RDAGTHDGLLVNQTELFVP--------------SLNVDGQPIFANITLPVYTLKERCLQVV-RSL 169
            ||..|.:.:.|....:|.|              .::|..:.:   |..|:.:|:|.||.:| |.|
  Fly    73 RDYYTGERMHVRSQRIFQPIRVRVPKSQQSPDQLVDVRSEVL---IHFPMRSLRENCLWLVARWL 134

Human   170 VKPENYRR 177
            ::..|..|
  Fly   135 IRTSNAPR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VHLNP_000542.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..65
Trypan_PARP <7..86 CDD:330686 7/30 (23%)
8 X 5 AA tandem repeats of G-[PAVG]-E-E-[DAYSLE] 14..53
pVHL 64..203 CDD:176472 35/138 (25%)
Involved in binding to CCT complex 100..155 16/68 (24%)
Interaction with Elongin BC complex 157..166 4/8 (50%)
VhlNP_001260885.1 pVHL 21..162 CDD:176472 32/125 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159728
Domainoid 1 1.000 42 1.000 Domainoid score I12433
eggNOG 1 0.900 - - E1_KOG4710
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107013
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.730

Return to query results.
Submit another query.