| Sequence 1: | NP_000542.1 | Gene: | VHL / 7428 | HGNCID: | 12687 | Length: | 213 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_594141.1 | Gene: | erj5 / 2541520 | PomBaseID: | SPAC2E1P5.03 | Length: | 303 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 45 | Identity: | 12/45 - (26%) |
|---|---|---|---|
| Similarity: | 16/45 - (35%) | Gaps: | 8/45 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Human 62 VLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTG 106 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| VHL | NP_000542.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..65 | 1/2 (50%) | |
| 8 X 5 AA tandem repeats of G-[PAVG]-E-E-[DAYSLE] | 14..53 | ||||
| VHL | 63..144 | CDD:460360 | 12/44 (27%) | ||
| Involved in binding to CCT complex | 100..155 | 3/7 (43%) | |||
| VHL_C | 156..204 | CDD:407332 | |||
| Interaction with Elongin BC complex | 157..166 | ||||
| erj5 | NP_594141.1 | PRK14288 | 40..>179 | CDD:172776 | 12/45 (27%) |
| DnaJ | 40..99 | CDD:395170 | 3/10 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||