DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and comt

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster


Alignment Length:619 Identity:176/619 - (28%)
Similarity:283/619 - (45%) Gaps:122/619 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   142 AYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLN---EVGY 203
            |.|.:|.|.|.    |...|:|:..|           ::.::.:|:...:...:..:|   :.|.
  Fly   168 AMRNVRFGRIL----GNTVVQFEKAE-----------NSSLNLQGKSKGKVVRQSIINPDWDFGK 217

Human   204 DDIGGCRKQLAQI-KEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAV-----ANET 262
            ..|||..|:...| :......:..|.|.:.:|.|..:||||||||||||||:||.:     |.|.
  Fly   218 MGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREP 282

Human   263 GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREKTHGE 319
            .    ::|||:|:.|..||||:|:|:.|.|||:....        ||..||:|||..:|....|.
  Fly   283 K----IVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGN 343

Human   320 --VERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQ 382
              |...:|:||||.:||:.|..:::|:..|||.:.||.||.|.||.:.:::|.:|:..||::||.
  Fly   344 SGVHDTVVNQLLTKIDGVDQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILN 408

Human   383 IHTKNM----KLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE-TIDAEVM 442
            ||||.|    |:.||||.:::|..|....||:|..|...|...|:.:   ||..:.: |:|.|.|
  Fly   409 IHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAAQSSAMNR---LIKADAKVTVDPEAM 470

Human   443 NSLAVTMDDFRWALSQSNPSA------LRETVVEVPQVTWEDIGG-----LEDVKRELQELVQYP 496
            ..|.|..|||..:|......|      :.:.::....:.|   |.     |||....:|:     
  Fly   471 EKLKVNRDDFLHSLEHDIKPAFGTAQEILDNMLARGVINW---GAPVSNLLEDGMLYVQQ----- 527

Human   497 VEHPDKFLKFGMTPSKG---VLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEA- 557
            .:.|:         |.|   ||..|.|..|||.||..:|......|:.:..||.:.   |.:|: 
  Fly   528 AKAPE---------SSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMV---GYTESA 580

Human   558 ---NVREIFDKA-RQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTK---- 614
               ::|:|||.| |....|::    :|::.:     :.|.|....|..|..|..:..:..|    
  Fly   581 KCLHIRKIFDDAYRSMLSCIV----VDNVER-----LLDYGSIGPRYSNMTLQALLVLLKKQPPK 636

Human   615 -KNVFIIGATNRPDIIDPAILRPGRLDQLIYIP---LPDEKSRVAILKANLRKSPVAKDVDLEFL 675
             :.:.|:..::|.::::...:... ...::::|   .||.      :.|.|..:.:....:::.:
  Fly   637 GRKLLILCTSSRREVLEEMEMLTA-FTSVLHVPNLSKPDH------VLAVLENTDIFSKGEIQAI 694

Human   676 AKMTNG---FSG----------ADLTEICQRACK 696
            .|...|   |.|          |..||..|||.|
  Fly   695 GKKMAGKRVFIGIKKLLGLIDMARQTEQSQRAIK 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 176/619 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 149/499 (30%)
AAA 256..397 CDD:278434 62/144 (43%)
AAA 539..668 CDD:278434 31/141 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.