DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and nmd

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001285801.1 Gene:nmd / 44021 FlyBaseID:FBgn0005322 Length:369 Species:Drosophila melanogaster


Alignment Length:322 Identity:114/322 - (35%)
Similarity:167/322 - (51%) Gaps:57/322 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   447 VTMDDFRWALSQSNPSA--------LRETVVE---------------------------VP---Q 473
            :|....:|.::|.:|::        |.|..::                           ||   .
  Fly    29 ITYYSVKWMMNQMDPTSKNKKKAKVLAEEQLKRLAEQEGFKLRGQEFSDYELMIASHLVVPADIT 93

Human   474 VTWEDIGGLEDVKRELQELVQYPVEHPD--KFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQ 536
            |:|.||.||:.|.:||:|.|..|::|.|  |..|....| ||||.:|||||||||:|||.|.|..
  Fly    94 VSWADIAGLDSVIQELRESVVLPIQHKDLFKHSKLWQAP-KGVLLHGPPGCGKTLIAKATAKEAG 157

Human   537 ANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVI 601
            ..||::....|...|:|||:.....:|..|.:..||::|.||:||..::|  |:.|....| .:.
  Fly   158 MRFINLDVAILTDKWYGESQKLTSAVFSLASRIEPCIIFIDEIDSFLRSR--NMNDHEATA-MMK 219

Human   602 NQILTEMDGMSTKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKS 664
            .|.:...||:||..|  |.::||||||..:|.||:|  |:....:|.||.|..|..|||..|:..
  Fly   220 TQFMMLWDGLSTNANSTVIVMGATNRPQDLDKAIVR--RMPAQFHIGLPSETQRKDILKLILQSE 282

Human   665 PVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDD 726
            .|::||||..|:|:||||||:||.|:|:.|....:|:.|.|.         :|||..::.::
  Fly   283 EVSQDVDLNRLSKLTNGFSGSDLREMCRNASVYRMRQLITSR---------DPSATALDRNN 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 114/322 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
nmdNP_001285801.1 AAA 132..266 CDD:214640 58/139 (42%)
AAA 135..265 CDD:278434 55/134 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.