DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and Nsf2

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001287318.1 Gene:Nsf2 / 41694 FlyBaseID:FBgn0266464 Length:752 Species:Drosophila melanogaster


Alignment Length:616 Identity:176/616 - (28%)
Similarity:278/616 - (45%) Gaps:133/616 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   144 RPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLN---EVGYDD 205
            |.:|.|.|.    |...|:|:..|           ::|::.:|....:...:..:|   :.|...
  Fly   175 RNVRFGRIL----GNTVVQFEKAE-----------NSVLNLQGRSKGKIVRQSIINPDWDFGKMG 224

Human   206 IGGCRKQL-AQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAV-----ANETGA 264
            |||..|:. |..:......:..|.|.:.:|:|..:||||||||||||||:||.:     |.|.. 
  Fly   225 IGGLDKEFNAIFRRAFASRVFPPELVEQLGIKHVKGILLYGPPGTGKTLMARQIGTMLNAREPK- 288

Human   265 FFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREKTHGE-- 319
               ::|||:|:.|..||||:|:|:.|.|||:....        ||..||:|||...|....|.  
  Fly   289 ---IVNGPQILDKYVGESEANIRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKARGSVAGNSG 350

Human   320 VERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIH 384
            |...:|:|||..:||::|..:::|:..|||.:.||.||.|.||.:.:::|.:|:..||::||.||
  Fly   351 VHDTVVNQLLAKIDGVEQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIH 415

Human   385 TKNM----KLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDET-IDAEVMNS 444
            ||.|    |:|.|||..::|.:|....||:|..|...|...|:.:   ||..:.:. :|.|.|..
  Fly   416 TKRMRDFNKIASDVDNNEIAAKTKNFSGAELEGLVRAAQSTAMNR---LIKADSKVHVDPEAMEK 477

Human   445 LAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKREL--QELVQY--PVEHPDKFLK 505
            |.||..||..||......|               .|..:::...|  :.::.:  ||   .:.|:
  Fly   478 LRVTRADFLHALDNDIKPA---------------FGAAQEMLENLLARGIINWGPPV---TELLE 524

Human   506 FGM--------TPSKG---VLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESE--A 557
            .||        |.|.|   ||..|.|..||:.||..:|......|:.:..||.: :.|.||.  .
  Fly   525 DGMLSVQQAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDFPFVKVCSPEDM-VGFTESAKCL 588

Human   558 NVREIFDKA-RQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVIN------------------- 602
            ::|:|||.| |....|::    :|::.:     :.|.|....|..|                   
  Fly   589 HIRKIFDDAYRSTLSCIV----VDNVER-----LLDYGPIGPRYSNLTLQALLVLLKKQPPKGRK 644

Human   603 ----------QILTEMDGMSTKKNVFIIGATNRPDII-----DPAILRPGRLDQLIYIPLPDEKS 652
                      .:|.||:.:|...:|..:...:.|:.:     |..:..|..| |.|...:..::.
  Fly   645 LLILCTSSRRDVLEEMEMLSAFTSVLHVSNLSTPENVLAVLDDSDLFSPEEL-QSIARKMAGKRL 708

Human   653 RVAILKA-----NLRKSPVAKDVDLEFLAKM 678
            .:.|.|.     .:|:|...:.| ::||:||
  Fly   709 CIGIKKLLALIDMIRQSEPHQRV-IKFLSKM 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 176/616 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
Nsf2NP_001287318.1 CDC48_N 9..89 CDD:215012
CDC48_2 117..>170 CDD:215011
AAA 259..404 CDD:214640 62/148 (42%)
AAA 261..402 CDD:278434 61/144 (42%)
AAA 543..674 CDD:214640 32/140 (23%)
P-loop_NTPase 544..>613 CDD:304359 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.