DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and CG16789

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_649910.3 Gene:CG16789 / 41154 FlyBaseID:FBgn0037712 Length:831 Species:Drosophila melanogaster


Alignment Length:466 Identity:102/466 - (21%)
Similarity:169/466 - (36%) Gaps:107/466 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    18 KQKNRPNRLIVDEAINEDNSVVSLSQPKM------DELQLFRGDTVLLK---GKKRREAVCIVLS 73
            |...|...|.|:|  |:|..|.....|.:      .|:.|| .||...|   |...:.|...::.
  Fly   377 KSPARSGDLNVNE--NQDEEVSFQPAPSVCLPDIRAEIDLF-NDTWRDKDETGVLSQAAYEDMIY 438

Human    74 DDTCSDEKIRMNRVVRNNLR-------VRLGDVISIQPCPDVKYGKRIHVLPIDD-TVEGITGNL 130
            .|...:.::...|.|.:.:|       ..:|..:........:.||:.......| |.:..|.:|
  Fly   439 SDKYQEVELEFRRAVDDVMRQEIELLQTAVGKKVKKSSKKTRRSGKKSKKKKEKDLTPDRTTESL 503

Human   131 FEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSP---------YCIVAPDTVIHCEG 186
            :|..:....:..|..:|... ||   |.:|:..: :.|:|||         |||:          
  Fly   504 YEELVTNGIIRKYPELRLKQ-FL---GDKALTAR-IGTNPSPGDIRQILTEYCIL---------- 553

Human   187 EPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGK 251
                         .:|.|.|..|...:                         |.|||.||.|:||
  Fly   554 -------------PLGSDAIHNCTPLI-------------------------RSILLAGPKGSGK 580

Human   252 TLIARAVANETGAFFFLINGPEIMSKLAGESE--SNLRKAFEEAEKNAPAIIFIDELDAIAP--- 311
            ..:..|:..|.||..|.:....|:.|..|:|.  ..:....:.:....||:||:.  ||..|   
  Fly   581 KALLHAICTEVGAVLFDLTPANIVGKYPGKSGLIMLIHLVLKVSRLLQPAVIFMG--DAERPFMK 643

Human   312 KREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATG 376
            |..||.....:|:...|..|:..:.....|:.:..:|.|...|..|.: ..::|.:.|..|| .|
  Fly   644 KIPKTDRTDPKRLKKDLPKLIKNIAPEDRVVFIGTSNLPWEADQKLLQ-SVYNRFIYIPRPD-YG 706

Human   377 RLEILQIHTKNMKLAD------DVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDE 435
            .:.    |.....|.|      ::|...:|..:.|:....:.| |.:..:...||    :.|..:
  Fly   707 AMS----HAWKTLLHDYSGGISNLDTSAMAKISDGYTIGSIDA-CLKEVMTCKRK----LQLRTQ 762

Human   436 TI-DAEVMNSL 445
            .: :||::|.|
  Fly   763 PLTNAELINVL 773

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 100/459 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
CG16789NP_649910.3 AAA 568..704 CDD:214640 38/138 (28%)
AAA 570..702 CDD:278434 37/134 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.