DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and pch2

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001287235.1 Gene:pch2 / 41013 FlyBaseID:FBgn0051453 Length:421 Species:Drosophila melanogaster


Alignment Length:245 Identity:67/245 - (27%)
Similarity:108/245 - (44%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   489 LQELVQYPVEHPDKFLKFGMTP---------------SKGVLFYGPPGCGKTLLAKAIANE---- 534
            |.|.:.|.....:|.|||.::.               ::.:|.:||||.|||.|.||:|.:    
  Fly   129 LWENLIYETGLKEKLLKFALSALMFSEHRVDTNVIACNRLILLHGPPGTGKTSLCKALAQKLSIR 193

Human   535 -----CQANFISIKGPELLTMWFGESEANVREIFDKARQAAP------CVLFFDELDSIAKARGG 588
                 ...:.:.|....|.:.||.||...|.::|:|..:...      ||| .||::|:|.||..
  Fly   194 TQGSYAYTHLVEINSHSLFSKWFSESGKLVAQLFNKIAELVSDPNNLVCVL-IDEVESLAYARSA 257

Human   589 NIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPD---- 649
            ...:....|.||:|.:||::|.:.|..||.|:..:|....||.|.:  .|.|..::|..|.    
  Fly   258 MSSNEPRDAMRVVNAVLTQLDSLKTCPNVLILATSNLAQSIDLAFV--DRADIRLFIGYPGISAI 320

Human   650 ---------EKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEI 690
                     |.....:|:..:.:|..|::..|..||:.:.|.||..|.::
  Fly   321 REIYKGMLAELMSAGVLQREVLESEDAEEGLLTQLAERSVGLSGRTLRKL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 67/245 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
pch2NP_001287235.1 AAA 166..315 CDD:214640 48/151 (32%)
AAA 169..314 CDD:278434 48/147 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.