DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and CG4701

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_609721.1 Gene:CG4701 / 34858 FlyBaseID:FBgn0028868 Length:384 Species:Drosophila melanogaster


Alignment Length:287 Identity:99/287 - (34%)
Similarity:156/287 - (54%) Gaps:11/287 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   474 VTWEDIGGLEDVKRELQELVQYPVEHPDKF--LKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQ 536
            ::|.||.||:...:||:|.|..||.|...|  .|....| ||||.:|||||||||:|||||.:..
  Fly    92 ISWSDIAGLDGTIQELRETVVLPVRHRKLFSRSKLWRAP-KGVLLHGPPGCGKTLIAKAIAKDAG 155

Human   537 ANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVI 601
            ..||::....|...|:|||:.....:|..|::..||::|.||::|..:.||.|..:   |...:.
  Fly   156 MRFINLDVGVLTDKWYGESQKLATAVFTLAKKLQPCIIFIDEIESFLRMRGSNDHE---ATAMIK 217

Human   602 NQILTEMDGMSTKKN--VFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKS 664
            .|.:.:.||:.:..|  |.::||||||..:|.||||  |:....:|.:|.:..|..||:..|:..
  Fly   218 TQFMLQWDGLMSNTNICVLVLGATNRPQDLDKAILR--RMPAQFHIGVPRDCQRREILQLILQTE 280

Human   665 PVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVP 729
            .::..|:|:.||::|.||||:||.|:|:.|....:|:.:..::....|...:....:.|..|...
  Fly   281 QLSPSVNLKELARLTIGFSGSDLRELCRHASMYRMRQFMREKLNTGEEIGKDKIEWDFEVKDQAL 345

Human   730 EIRRDHFEEAMRFARRSVSDNDIRKYE 756
            : ..:|.|..|....:|:|.....|::
  Fly   346 Q-EWEHLEIQMEDLLKSLSVMKASKHQ 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 99/287 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
CG4701NP_609721.1 Parvo_NS1 47..>152 CDD:305166 32/60 (53%)
AAA 130..265 CDD:214640 56/140 (40%)
AAA 133..265 CDD:278434 53/136 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.