DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and CG4908

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_609358.1 Gene:CG4908 / 34360 FlyBaseID:FBgn0032195 Length:431 Species:Drosophila melanogaster


Alignment Length:172 Identity:52/172 - (30%)
Similarity:79/172 - (45%) Gaps:17/172 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   205 DIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLI 269
            |.|..::.:|..::.::..|    .:...|:...||.|||||||.||:....|:|.|......|:
  Fly   195 DRGTSQRIIADCQDFIKSSL----WYTQRGIPYRRGYLLYGPPGCGKSSFITALAGELEYSVCLL 255

Human   270 NGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGE------VERRIVSQL 328
            |..|     .|.::..|......|.:.  :||.::::||....||.|..:      :.|...|.|
  Fly   256 NLSE-----RGLTDDRLNHLLNVAPEQ--SIILLEDIDAAFVSREATPQQKSAFDGLNRITFSGL 313

Human   329 LTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIG 370
            |..:||:......||...||..:.:||||.|.||.|.:..||
  Fly   314 LNCLDGVGSTEARIVFMTTNYIDRLDPALVRPGRIDLKEYIG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 52/172 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
CG4908NP_609358.1 BCS1_N 23..192 CDD:214980
RecA-like_BCS1 202..354 CDD:410918 48/162 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.