DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and Fign

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001259995.1 Gene:Fign / 33544 FlyBaseID:FBgn0031519 Length:523 Species:Drosophila melanogaster


Alignment Length:398 Identity:118/398 - (29%)
Similarity:195/398 - (48%) Gaps:57/398 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   394 VDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTM--------- 449
            :|.:|.::|:....|........:..:..::||......|.:.:...:||....|:         
  Fly   138 IDAQQYSSESSSQSGFGFRTAREQLIMDELKKKNRQATSEVDAVPTGMMNFRKKTLGGKRTVSSN 202

Human   450 --------DDFRWALSQSNPSALR------------ETVVEVPQVTWEDIGGLEDVKRELQELVQ 494
                    |:...:.|.|.|.||.            |::.:...|.||||.|||..|....|.:.
  Fly   203 FVSPVAQNDNSTSSRSSSIPPALAHLDSKMVDHILGESMHDFKPVAWEDIAGLESAKSTFLEAII 267

Human   495 YPVEHPDKFLKFGM-TPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEAN 558
            .|:..||.|.  |: .|.:|||.:||||.||||:||:||::.:|.|.||....|.:.|.|::|..
  Fly   268 MPLRRPDLFT--GVRCPPRGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKL 330

Human   559 VREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKK--NVFIIG 621
            |:.:|..|....|.::|.||:||:...|..|..:   :..|:.|:.|..:||.::.:  .|.:||
  Fly   331 VKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENE---STLRLKNEFLIHLDGAASNEEIRVLVIG 392

Human   622 ATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLE---FLAKMTNGFS 683
            |||||..:|.|:.|  |..:.:|:|||..::|..|::..:.:  |..::|:.   .||::|:|:|
  Fly   393 ATNRPQELDEAVRR--RFVRRLYVPLPTREARQKIIEKLIHQ--VKHNLDVRQVIELAELTDGYS 453

Human   684 GADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVS 748
            |||:..:|:.|....:             |...|..|||.|...:|.:..|.|::|:|...:|||
  Fly   454 GADVDTLCRYASMAPL-------------RSLTPDQMEVIETHQLPAVTMDDFKQALRVISKSVS 505

Human   749 DNDIRKYE 756
            ..|.:::|
  Fly   506 SEDCKQFE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 118/398 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
FignNP_001259995.1 AAA 282..418 CDD:214640 55/140 (39%)
AAA 286..416 CDD:278434 51/134 (38%)
Vps4_C <480..520 CDD:286426 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.