DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and Rpt6

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:377 Identity:129/377 - (34%)
Similarity:210/377 - (55%) Gaps:24/377 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   344 MAATNRPNSIDPALRRFGRFD-------REVDIGIPDATGRLEILQ-----IHTKNMKLADDVDL 396
            |..||| ..|:.|..:...|.       .|:.:.:.:....|..||     ::.|...|.:::.|
  Fly     1 MTVTNR-MEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQL 64

Human   397 EQVANETHGHVGADLAALCSEAALQAIRKK-MDLIDLEDETIDA-EVMNSLAVTMDDFRWALSQS 459
            .|   |...:||..:..:..:..|..:..: ..::|| |:.||. :|..:..|.:.:..:.|.:.
  Fly    65 LQ---EQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDL-DKNIDINDVTPNCRVALRNESYTLHKI 125

Human   460 NPSALRETV----VE-VPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGP 519
            .|:.:...|    || ||..|:|.:|||:...:|::|:::.||:||:.|...|:...||||.|||
  Fly   126 LPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGP 190

Human   520 PGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAK 584
            ||.||||||:|:|:..:..||.:.|.||:..:.||....|||:|..||:.||.::|.||:|||..
  Fly   191 PGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGS 255

Human   585 ARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPD 649
            :|..:...|.....|.:.::|.::||....||:.:|.||||.||:|||:|||||:|:.|..|.|:
  Fly   256 SRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPN 320

Human   650 EKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE 701
            |::|:.|||.:.||..:.:.::|..:|::..|.|||::..:|..|...|:||
  Fly   321 EEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 129/377 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 123/360 (34%)
SlyX <27..>69 CDD:294687 9/44 (20%)
AAA_16 152..>205 CDD:289934 27/52 (52%)
AAA 185..317 CDD:278434 61/131 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.