DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and CG10793

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:291 Identity:92/291 - (31%)
Similarity:156/291 - (53%) Gaps:37/291 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   187 EPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGK 251
            |.:|....:|:: ::.:.|:.|.::.:..|||.|..|:..|.|| |.|:||.|.:||:||||:||
  Fly   190 ELVKTSILQENI-KIKWSDVCGNQRAIELIKEAVLTPIEFPQLF-AHGLKPWRSLLLHGPPGSGK 252

Human   252 TLIARAVANET--GAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKRE 314
            ||:|:|:.:||  ...||.|....::||..||||..||..|..|.|.||::||.||::::..||:
  Fly   253 TLLAKALYSETQGQVTFFNITASIMVSKWRGESEKILRVLFHMAAKRAPSVIFFDEIESLTSKRD 317

Human   315 K-THGEVERRIVSQLLTLMDGLKQRAH-VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGR 377
            : |..|..:|..::||.|:||::...: |.|:|:||.|..||.|..|  ||::::.:.:|:|..|
  Fly   318 RATDHESSKRFKNELLQLLDGMEHSLNGVFVLASTNLPWDIDEAFLR--RFEKKLLVQLPNAAER 380

Human   378 LEILQIHTKNMKLADDVD-----LEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETI 437
            ..::     |..|...:.     |||:...:....|.::...|.|.::..:|....:.|      
  Fly   381 SCLI-----NRLLGSSISLNPRLLEQLVEISDHFTGDEIRLACKEISMHRVRCATKIGD------ 434

Human   438 DAEVMNSLAVTMDDFRWALSQSNPSALRETV 468
                 .|:.:        |::.:|:|:...|
  Fly   435 -----RSIGL--------LAKESPAAIEANV 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 92/291 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
CG10793NP_570054.2 LisH 31..56 CDD:285685
P-loop_NTPase 205..>259 CDD:304359 26/54 (48%)
AAA 238..376 CDD:214640 58/139 (42%)
AAA 242..374 CDD:278434 56/133 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.