DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCP and CG31495

DIOPT Version :9

Sequence 1:NP_009057.1 Gene:VCP / 7415 HGNCID:12666 Length:806 Species:Homo sapiens
Sequence 2:NP_001287320.1 Gene:CG31495 / 261626 FlyBaseID:FBgn0051495 Length:341 Species:Drosophila melanogaster


Alignment Length:329 Identity:68/329 - (20%)
Similarity:116/329 - (35%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   367 VDIGIPDATGRLEILQIHTK---NMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMD 428
            |:|.:|:...|:.:|:....   ::.:|.||...::|.:|......:|..|..||..:||.:   
  Fly     2 VNITLPNTEERVNLLKSRINRLGDITVAGDVCAREIAMKTKNFTEDELCQLVREALHEAIVR--- 63

Human   429 LIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELV 493
                   |........|.||..|...|:....|...|:                   :..||.|:
  Fly    64 -------THVTRCPKGLQVTQVDLLAAVKIIQPRFGRQ-------------------EETLQLLM 102

Human   494 QYPVEH-------PDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFIS-IKGPELLTM 550
              |.|:       |:..|..|.......|..|.|..|.|.:|..:|.:....||. |...|||.:
  Fly   103 --PYEYLDRTAFDPNDLLSTGRPRWSCHLVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLGL 165

Human   551 WFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKK 615
            ...|....:||:.:.|..:....:..|:.:.:       || .|....|...:.|.::..:..|:
  Fly   166 SDSEKCQRIREVLEDAYVSRRSCVIIDDFERV-------IG-YGALGKRYSKEFLQKLTVLLKKQ 222

Human   616 -----NVFIIGATNRPDIID--------------PAILRPGRLDQLIYIPLPDEKSRVAILKANL 661
                 .:.||..:||.|:::              |.:..|              |..:.|::|:.
  Fly   223 PPNSHELIIICTSNRLDVLEELGLLSVFTSVHNVPNVSTP--------------KELMVIVEASK 273

Human   662 RKSP 665
            |..|
  Fly   274 RFEP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCPNP_009057.1 CDC48 25..764 CDD:273521 68/329 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000269|PubMed:18656546 797..806
PIM motif. /evidence=ECO:0000269|PubMed:24726327 802..806
CG31495NP_001287320.1 AAA 129..259 CDD:214640 30/137 (22%)
P-loop_NTPase 129..257 CDD:304359 29/135 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.