DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VCAM1 and DIP-lambda

DIOPT Version :9

Sequence 1:NP_001069.1 Gene:VCAM1 / 7412 HGNCID:12663 Length:739 Species:Homo sapiens
Sequence 2:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster


Alignment Length:384 Identity:88/384 - (22%)
Similarity:145/384 - (37%) Gaps:65/384 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   261 KLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGV-NLIGKNRKEVELIVQEKPFTVEISPGPRIA 324
            |:.||.|       ..::..:.::...|..|..| ::.||...| |:   :..|..::|   ...
  Fly    10 KMYNGTL-------ACSIAFILIKAITITKCHAVAHIHGKGESE-EI---DPQFLAKLS---NTT 60

Human   325 AQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSG------------KVRSEGTNS-TLTLSPVSFE 376
            ..||..:..||.|........:|.......:.|            .|...|.|: .|.:|.|...
  Fly    61 VPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQIN 125

Human   377 NEHSYLCTVTCGHKK-----LEKGIQVELYSFP-RDPEIEMSGGLVNGSSVTVSCKVPSVYPLDR 435
            :..||:|.|.....|     |:..:..::.:.| .:||   .|....|.|:::.|.|..| |..:
  Fly   126 DSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPE---DGVCQEGGSISLMCSVTGV-PRPK 186

Human   436 LEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQ 500
            :......|:.|:...:..:.|..||:|.:.|.:|.:.. .|.| ...|.|...|      |....
  Fly   187 VLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQR-SDMG-GYNCIASNGI------PPSVS 243

Human   501 STQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILWSR-----QLPNGELQPLSE 560
            ....:|||.:|....:.....:.:|.  .|.:.|:.:.||.|...|.|     :|.||....:||
  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVER--EVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISE 306

Human   561 --------NATLTLISTKMEDSGVYLCEGINQAGRSRKEVEL-IIQVTPKDIKLTAFPS 610
                    :..||:......|.|.|.|..:|..|:|...:.| .:::.|   |||..|:
  Fly   307 EVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPP---KLTTTPT 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VCAM1NP_001069.1 IG 33..112 CDD:214652
Ig_VCAM-1 116..214 CDD:143313
IGc2 238..298 CDD:197706 7/37 (19%)
I-set 313..399 CDD:333254 21/103 (20%)
Ig_VCAM-1 404..502 CDD:143313 24/98 (24%)
IG_like 519..596 CDD:214653 23/90 (26%)
IG 609..685 CDD:214652 1/2 (50%)
DIP-lambdaNP_001334747.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.